La formación de los editores en España, el ICAL y la Feria de Leipzig de 1914.

Según datos recogidos por Jesús A. Martínez Marín en «La edición artesanal y la construcción del mercado»: «En 1879, del total de 51 editores censados en el padrón fiscal [español], 41 tenían domiciliada su actividad en Madrid, 7 en Barcelona y 3 en las provincias de Guadalajara, Lérida y Sevilla, respectivamente». A tenor de estas cifras, resulta bastante asombroso constatar que, según las mismas fuentes, «al terminar el siglo Madrid y Barcelona son los dos centros de la edición, con 44 y 35 editores respectivamente», pues de ser fiables esos datos resulta espectacular el crecimiento en número de editores en la capital catalana, tanto en términos absolutos como en porcentuales en el conjunto de los españoles.

Eudald Canivell i Masbernat.

Es probable que algo tuviera que ver en ello la iniciativa que empezó a fraguarse en otoño de 1897 en una reunión convocada por el dibujante, tipógrafo, impresor y bibliotecario anarquista Eudald Canivell i Masbernat (1858-1928) en casa del cajista e impresor Josep Cunill, con la participación también del excajista, dibujante y cronista gráfico anarquista Josep Lluís Pellicer i Fenyé (1842-1901), con el propósito de crear un centro que diera una formación más completa y rápida que la que hasta entonces obtenían los profesionales, que se basaba casi exclusivamente en la experiencia acumulada desde el puesto de aprendiz hasta el de maestro.

Un año más tarde, en noviembre de 1898, se constituía formalmente el Institut Català de les Arts del Llibre (ICAL), con la participación también del impresor y editor Josep Thomàs i Bigas (1852-1910), el librero y editor Àlvar Verdaguer, el impresor Fidel Giró Brouil (1849-1926), el escritor y editor Joaquim Casas Carbó (1858-1943) y el tipógrafo e impresor Joan Rusell i Anglarill (1862-1923); como puede advertirse, todos ellos rondando la cuarentena en aquel entonces.

Dos años después de su fundación formal ya contaba con una cabecera que les serviría de portavoz, la Revista Gráfica, cuyo primer director fue el mencionado Pellicer y que se publicó periódicamente entre 1900 y 1928 (salvo los años 1924 a 1927), en los primeros años en la prestigiosa imprenta especializada en libros de bibliófilo Oliva de Vilanova, fundada apenas unos años antes (en 1899) por Joan Oliva i Milà (1858-1911). Paralelamente, en 1900 los editores habían creado el Centre de la Propietat Intel·lectual, la primera asociación de estas características en España y entre cuyos primeros asociados figuraba uno de los dos fundadores de la editorial Montaner y Simon,  Francesc Simon i Font (1843-1923) y otros editores importantes, como Manuel Maucci (1859-1937), Josep Espasa i Anguera (1840-1911), los hermanos Joan y Gustau Gili, Antoni López i Benturas (1861-1931), Francesc Seix i Faya o el impresor Manuel Tasso i Serra, entre otros.

Josep Lluís Pellicer i Fenyé.

Según la detallada reconstrucción que hace Manuel Llanas de los pasos iniciales del ICAL, en 1905 empieza a funcionar activamente la Escola Pràctica de les Arts del Llibre en la misma sede que el ICAL (en los bajos de lo que hoy es el número 153 de la calle Claris) y con el siguiente programa:

Tipografía (subdividida en dos secciones: cajas y máquinas), composición a máquina, litografía, encuadernación, dibujo y gramática castellana. —Y prosigue Llanas—: Y si el profesorado lo integraban, en ocasiones, prestigiosos impresores y tipógrafos (Ceferí Gorchs, Ramon Tobella, Fidel Giró, Joan Russell), el alumnado asistía, por mandamiento estatutuario, de forma totalmente gratuita. De media, oscilaba alrededor de los doscientos matriculados, la gran mayoría aprendices en diversos talleres gráficos; por eso las clases se hacían entre las 20 y las 21.30 h., de lunes a sábado, y alguna vez incluso las mañanas de los domingos. Los únicos requisitos que se exigían para entrar eran haber cumplido los trece años y saber leer y escribir.

Bajo la presidencia del mencionado Francesc Simon i Font (1843-1923), que desde su fundación y hasta 1903 había presidido la junta directiva del Centre de la Propietat Intel·lectual, el ICAL experimenta un notable impulso y se aprueban unos nuevos estatutos que definen del siguiente modo el segundo de sus objetivos (el primero es la docencia): «Establecer solidaridad y facilitar las relaciones profesionales cuando éstas se relacionen con las Artes del Libro».

Logo de Montaner y Simon.

Además de organizar el I Congrés Internacional de les Arts del Llibre (1911), como consecuencia del cual nació la Unió Patronal de les Arts del Llibre (germen a su vez de la Unió Sindical de les Indústries del Llibre) y procurar la participación de sus socios en algunas ferias internacionales y presentar conjuntamente sus reivindicaciones ante las autoridades, uno de los mayores logros del ICAL fue la participación de los profesionales catalanes en la importante Feria de Leipzig en 1914, que conmemoraba el quinto centenario de la Real Academia de Artes Gráficas y de la Industria del Libro, y cuya organización y desarrollo, en cuanto atañe a la participación española, Philippe Castellano ha reconstruido con mucho detalle.

Ya en octubre de 1912 Ludwig Wolkmann, como presidente tanto de la Sociedad Alemana de Artes Gráficas como de la Junta Directiva de la Exposición, propuso que se organizara una representación española al editor español que mejor conocía, el madrileño Enrique Bailly-Baillière y Plano, quien se había formado como librero-editor en Alemania y había sido uno de los promotores de la conocida –para abreviar– como Asociación de la Librería de España (Asociación de la Librería, de la Imprenta, del Comercio de la Música, de los Fabricantes de Papel y de todas las Industrias y Profesiones que concurren en la fabricación del Libro y a la publicación de obras de literatura, ciencia y arte); incluso lo nombra presidente de la Junta Organizadora para España.

Sin embargo, pese a iniciar gestiones (infructuosas) para obtener financiación, Bailly-Bailliere topa enseguida con la oposición del editor catalán Manuel Henrich Girona, por entonces presidente de la Federació de les Arts del Llibre, lo cual le lleva a dimitir en noviembre de ese mismo año, lo que ofrece al gobierno español el pretexto idóneo para desentenderse del asunto y evitar comprometer ningún tipo de partida presupuestaria para la participación española en la exposición.

Así las cosas, el ICAL decide participar en la feria por su cuenta y riesgo, y en septiembre de 1913 crea un comité organizador con Manuel Henrich, August Heinrich Höfer, Ramon Miquel i Planas, A. Cardunets, P. Cruells, J. Fabré, J. Furnells, F. Mestres y Russell. Aun así, Bailly-Ballière, también extraoficialmente tras su dimisión, seguía haciendo gestiones y manteniendo correspondencia con el comité organizador alemán incluso en el verano de 1913. Por su parte, la Revista Gráfica se había hecho eco de la vergüenza que suponía que un país con una industria editorial como la española no participara en una feria tan importante como la de Leipzig, y esa misma queja se repite en diversos números de la revista del ICAL, siempre en vano.

Colofón del segundo volumen de Revista Gráfica.

En septiembre de 1913 desde el ICAL se empiezan a solicitar propuestas de participación en la feria alemana y a crear un comité organizador, con lo que se da la paradójica situación de que avanzan en paralelo dos líneas de trabajo para un mismo fin (una en Barcelona y otra en Madrid), ambas sin contar con un compromiso en firme de participación estatal. Y, en una nueva vuelta de tuerca, al enterarse de la existencia de un comité en Madrid, el del ICAL se disuelve, poco antes de que, ante la nueva imposibilidad de obtener fondos del gobierno, Bailly-Ballière renunciara por segunda vez a presidir el comité organizador. De todos modos, el ICAL sigue adelante con la organización de una presencia extraoficial en la feria y en la primavera de 1914 la Revista Gráfica publica ya un listado de 55 participantes comprometidos, y la iniciativa es saludada con entusiasmo por parte de la prensa barcelonesa.

No tardan en sumarse a la iniciativa del ICAL diversas empresas de otros puntos de la península, y en su número de mayo el órgano de la Federación Nacional de las Artes del Libro ensalza el empeño y el empuje que están poniendo los profesionales catalanes en esa iniciativa:

El Instituto Catalán de las Artes del Libro de Barcelona ha tomado la iniciativa de organizar una Exposición colectiva de sus socios, a la cual se han adherido varias casas del ramo gráfico de Madrid […] Actualmente se está trabajando febrilmente en Leipzig en la instalación y decorado de la sección española […]; de modo que es de esperar que la sección española se presentará dignamente en aquel certamen internacional de cultura, al cual acudirán todas las naciones del mundo. Hay que felicitar calurosamente al Instituto Catalán de las Artes del Libro y a los organizadores de la Exposición española por su altruista labor y trabajo en favor del ramo gráfico de España, que han conseguido, por fin, que sea un hecho la participación y representación de España en la Exposición Internacional de Leipzig.

Finalmente fueron setenta los expositores representados: 51 barceloneses, 1 de Sabadell, 1 de Sant Feliu d Guíxols, 1 de València y 15 de Madrid, desproporción que en su imprescindible estudio de este caso Castellano atribuye tanto a la asunción de la organización por parte del ICAL como al desplazamiento que ya se había producido en cuanto a la capitalidad editorial en España de Madrid a Barcelona, y que en alguna medida cabe atribuir al evidente interés por formar a buenos profesionales que permitieran ofrecer una calidad equiparable, por ejemplo, a la de la industria editorial alemana.

Espacio del ICAL en la Feria de Leipzig de 1914.

Fuentes:

Anónimo, «La Exposición de Artes Gráficas de Leipzig», Federación Nacional de las Artes del Libro, Año I, núm. 2 (marzo de 1914), p. 10.

Anónimo, «Exposición de Leipzig», Federación Nacional de las Artes del Libro, Año I, núm. 4 (mayo de 1914), pp. 8-12.

Eudald Canivell, «Ecos. El Temps», El Poble Català, núm. 3299 (28 de marzo de 1914), p. 1.

Philippe Castellano, «La Sala Espanyola en l’Exposició Internacional de les Arts Gràfiques i de la Industria del Llibre, Leipzig 1914 (o com va voler fer-se Pàtria mitjançant el llibre)», traducción de Anna Carreras, Els Marges, núm. 71 (desembre de 2002), pp. 89-106.

Manuel Llanas, con la colaboración de Montse Ayats, L’edició a Catalunya: el segle XX (fins a 1939), Barcelona, Gremi d’Editors de Catalunya, 2005.

Manuel Llanas, Caires de l’edició catalana en el segle xx, Lección inaugural del curso 2011-2012 de la Facultat d’Educació, Traducció i Ciències Humanes de la Universitat de Vic.

Jesús A. Martínez Martín, «La edición artesanal y la construcción del mercado», en Jesús A. Martínez Martín, dir., Historia de la edición en España (1836-1936), Madrid, Marcial Pons, 2001, pp. 29-71.

Un acercamiento a la edición en español en Rusia

Es muy probable que, si bien las relaciones entre algunas organizaciones políticas y culturales son bastante anteriores, la primera iniciativa de una cierta importancia de editar en Moscú obras en español se remonte a 1931, cuando se crean las Ediciones Cooperativas de los Trabajadores Extranjeros en la URSS.

Rafael Giménez-Siles.

En consonancia con la política soviética de aquellos años, vehiculada en buena medida por la agencia VOLKS (Sociedad para las Relaciones Culturales con el Exterior), las ediciones se orientaron, por un lado, a los textos de teoría política más recientes y, por otro, en respuesta a la demanda existente en España, a la literatura, pero, según cuenta Kowalsky en su impresionante estudio sobre la presencia soviética en la guerra civil,, «del mismo modo que la agencia rechazaba categóricamente cualquier colaboración con los viejos rusos emigrados no imbuidos de las doctrinas y costumbres soviéticas, tampoco dudaba en disuadir a los traductores españoles de que intentaran abordar la literatura prerrevolcionaria». Las ediciones de Cenit de Rafael Giménez Siles son buena muestra de este tipo de textos –que hacían poco menos que prescindible la publicación de traducciones al español en Moscú–, lo que permite a Mario Bueno Aguado describir del siguiente modo las ediciones en el cambio de década:

Entre 1928 y 1932, [Cenit] publicó libros de índole literaria (colecciones de Novelistas Nuevos, La Novela Proletaria, La Novela de Guerra, La Novela Histórica, Cuentos Cenit para niños), ensayos (Crítica Social, Las Realidades del Capitalismo, Documentos Vivos, Panorama) o incluso biografías (Vidas Extraordinarias). De estas colecciones destacan sobre todo autores alemanes y soviéticos. Entre 1932 y 1934 se produce un auge de las publicaciones marxistas, destacando las colecciones Biblioteca Carlos Marx, Cuadernos Mensuales de Documentación Política y Social, Cursos de Iniciación Marxista, Divulgación, Documentos de Comunismo, Episodios de la Lucha de Clases, etc.

En relación a la mencionada presencia de autores alemanes, no será ocioso recordar que, en buena medida, si Cenit pudo dar a conocer a ciertos autores extranjeros fue gracias a sus acuerdos con editoriales como las alemanas Malik-Verlag, Verlag für

Literatur und Politik o Fischer. Por su parte, en el ámbito de la literatura alemana, las Ediciones Cooperativas contaron por aquel entonces con algún nombre relativamente conocido, como es el caso de la escritora Maria Osten (1908-1941), que como consecuencia de la llegada de los nazis al poder acababa de dejar su empleo en la revolucionaria editorial vanguardista Malik (donde una fotografía de sus célebres ojos habían servido a John Heartfield para elaborar el montaje que creó para la cubierta de Die Liebe der Jeanne Ney, de Ilyá Ehrenburg).

La primeras ediciones importantes en español de las Ediciones Cooperativas se produce, en buena lógica, cuando en España se acumulan las dificultades para publicar debido al avance de la guerra civil española: La guía de los sindicatos soviéticos (para las delegaciones obreras) (1937), de Solomon Abrámovich Losovsky (1878-1952) y el Compendio de historia de la URSS (1938) de A. Shestakov, una cuidada edición encuadernada en tela que incluye ilustraciones, láminas y cuatro mapas desplegables, que casi coincide en el tiempo con la aparición en la Península de España en la Unión Soviética, del filólogo, lingüista y bibliotecario Tomás Navarro Tomás (1884-1979), publicado por las Ediciones Amigos de la Unión Soviética.

Poco después de acabar la guerra civil, las Ediciones Cooperativas de los Trabajadores Extranjeros en la URSS simplificaban su nombre por el de Ediciones en Lenguas Extranjeras, homónimo al que tomaría por ejemplo en China una iniciativa similar.  Por esos mismos años aparecen muchas traducciones del ruso en la versión española de Internatsionálnaia Literatura (Literatura Internacional), creada en 1942 y en la que ejerce de redactor-jefe el escritor César M. Arconada (1898-1964), que a menudo traducía en colaboración con el hispanista Fédor Kelin (1893-1965), traductor a su vez de José Bergamín y César Vallejo al ruso. En esta etapa posterior a la Segunda Guerra Mundial, son varios los refugiados españoles que entran a trabajar en la editorial, como es el caso en 1947 del militar republicano Pedro Prado Mendizábal (1902-1985), autor de un Diccionario politécnico español-ruso (1964), antes de establecerse en Cuba. También el del abogado socialista Antonio Pretel Fernández (1903-1980) y el del poeta Julio Mateu Martínez (1908-1985), a quien la Editorial Progreso le publicaría en Rusia sus Poesías escogidas (1972) y Olivos y abedules (1977). Y de 1949 es, en la Ediciones en Lenguas Extranjeras, la Antología de la literatura española. Siglo XX, preparada por Kelin e I. Tiniánova.

El maestro y traductor Ángel Herráiz Comas (1907-1976) se incorporó también a las Ediciones en Lenguas Extranjeras, para las que vertió al español varias obras de Gorki (Cuentos en Italia, 195?; Los Armóntov, 1953, y Por el mundo. Mis universidades, 195? y varias veces reeditado), en ocasiones en colaboración con José Vento  Molina (1918-1988), y a partir de finales de los años sesenta colaboró también esporádicamente con algunas editoriales españolas, como Ciencia Nueva y Zero. En esos mismos años, aunque muchas de estas ediciones no están fechadas, se ocupó de la redacción del libro colectivo En memoria de Julián Grimau, que incorpora artículos de César Arconada, Hugo Ruppert y Juan Rejano, además de un poema de Rafael Alberti.

Arturo del Hoyo.

El mencionado periodista y traductor José Vento, que estuvo al frente de la versión española de la revista Literatura Soviética, publicó para la misma editorial una enorme cantidad de títulos de Chéjov, Pushkin, Tolstoi, Sholojov y Simonov, además de algunos otros títulos para la editorial Ráduga (dedicada a la publicación de textos literarios y que en 1982 se desgajó de lo que ya por entonces se llamaba Editorial Progreso). Sin embargo, entre el fin de la Segunda Guerra Mundial y 1957 (en que regresa a España), la más conocida traductora literaria al español de las Ediciones en Lenguas Extranjeras fue sin duda Lydia Kúper (1914-2011). Como ella, no fueron pocos los traductores que en esa época regresaron a España y, a menudo gracias a la astucia y sensibilidad del gran editor Arturo del Hoyo (1917-2004), que a principios de esa década había sustituido a Federico Carlos Sáinz de Robles (1898-1982) como asesor literario de Aguilar, como consecuencia de ello la cantidad y calidad de las traducciones del ruso publicadas en España aumentó sensiblemente.

A partir de 1963 se inicia una remodelación organizativa que lleva aparejado un nuevo cambio de nombre, el definitivo, a Editorial Progreso, y de ese mismo año son las casi mil páginas de los Fundamentos del Marxismo-Leninismo. Empieza entonces la época más conocida de la editorial, en que sigue publicando muchos títulos de temas políticos e históricos, como el colectivo editado por Ivan M. Maisky, N.N. Voronov e I.N. Nesterenko sobre la participación soviética en la guerra civil española Bajo la bandera de la España republicana (1967) o el también colectivo, encabezado en ese caso por Dolores Ibárruri, Guerra y revolución en España, publicado en cuatro enormes volúmenes (1967-1971). Sin embargo, también hay espacio muy destacado para la literatura, con la publicación de El Don apacible (1973) de Sholojov en dos volúmenes (traducción de José Laín Entralgo), la de una segunda edición de Campos roturados (1966), también de Sholojov, o de títulos menos conocidos como Esta es su causa, de Yuri Guerman (1975), La daga (1977) de Anatoli Ribakov o El sauquillo rojo (1979), de Vasili Shukshin, entre otras novelas, y además al final de esta etapa (que concluye en 1982) se inicia también la publicación de la revista América Latina (del departamento de América Latina del Instituto de Ciencias de la URSS). Mención aparte merece la publicación en 1976 de Veo lo que viene y lo que nace. Obra escogida, de Pablo Neruda, un volumen de casi quinientas páginas encuadernadas en tapa dura con un formato de 20 x 15, o el volumen antológico ilustrado de García Lorca Prosa. Poesía. Teatro (1979).

Un año después y como producto también de esa remodelación aludida nacía la Editorial MIR, destinada sobre todo a la literatura técnica y científica, pero también con una muy prestigiosa colección de narrativa de ciencia ficción y de la que muchos aficionados recuerdan antologías del género como Café molecular (1967) (Alexander Poleschuk, Anatoli Dneprov, Boris Strugatski, etc.), Viaje por tres mundos (1969) (Alexander Abramov, Eremei Parnov, Ilva Varshavsky, etc.), Devuélvanme mi amor (1971) (Sávchenko, Gansovski, Zhuralvliova) o La caja negra (1984) (Dneprov, Dmitri Bilenkin, Varshalavsky); libros todos ellos que, en tiempos aún del Telón de Acero, eran de los muy escasos contrapesos a la ciencia ficción estadounidense y británica que podían leerse en España, adonde llegaban sobre todo gracias a la decidida voluntad de la legendaria saga de libreros madrileños de la Rubiños-1860, a los que no por casualidad se conocía también como los «Rusiños» y que incluso coeditaron en algunos casos con editoriales rusas, como Ráduga.

Una vez desgajada en 1982 también Ráduga (dedicada a la literatura) de la casa madre, en la Editorial Progreso aún se publicarían traducciones e incluso obras en español como Lenin. Vida y actividad (1985), obra colectiva encabezada por A. Amelina y A. Averianova, pero también libros de literatura, como una edición (¿reedición?) de la Obra escogida del venezolano Miguel Otero Silva (1908-1985) y un volumen de Relatos de autores soviéticos ese mismo 1982 o el ensayo de Henry Luque Muñoz Dos clásicos rusos.Turgueniev, Saltikov, Schedrin (1989) o Del Amazonas al Lena, de Apolinar Díaz-Callejas.

Una imagen del Sputnik y la P en alfabeto cirílico formaban el logo de la Editorial Progreso.

A partir de 1991, cuando el gobierno retiró las subvenciones que sustentaban la empresa, se vivió en la Editorial Progreso un momento bastante crítico (que conllevó el despido de la mitad de los empleados) y desaparecieron muchas de las secciones dedicadas a la traducción a otras lenguas, pero la edición en español, si bien muy mermada, tuvo continuidad con una red de distribución restringida al territorio ruso y con una producción mucho más modesta.

Fuentes:

Manuel Aznar Soler, «Teatro, literatura y cultura del exilio republicano español en la Unión Soviética (1939-1949)», en Exils et migrations ibériques, núm. 6 (1999), pp. 61-78.

Manuel Aznar Soler y José Ramón López García, eds., Diccionario biobibliográfico de los escritores, editoriales y revistas del exilio republicano de 1939, Sevilla, Renacimiento, 2017.

Daniel Kowalsky, La Unión Soviética y la guerra civil española. Una revisión crítica, traducción de Teófilo de Lozoya y Juan Rabasseda-Gascón,  Barcelona, Crítica, 2003.

Marcos Rodríguez Espinosa, «Acerca de los traductores españoles del exilio republicano en la URSS: El Grupo de Moscú y la difusión de la literatura rusa en España en la segunda mitad del siglo XX», en Francisco Ruiz Noguera y Juan Jesús Zaro Vela, Retraducir: una nueva mirada: la retraducción de textos literarios y audiovisuales, Málaga, Miguel Gómez Ediciones, 2007, pp. 243-262.

Mario Bueno Aguado, «Semblanza de Editorial Cenit (1928-1936)». En Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIXXXI) – EDI-RED (2016): http://www.cervantesvirtual.com/nd/ark:/59851/bmcj69d8

 

González Porto y la edición culturalmente ambiciosa

El nombre del legendario José María González Porto (1895-1975) ha quedado casi indeleblemente asociado a la mexicana Unión Tipográfica Editorial Hispano Americana (UTEHA) y en particular a la edición de su impresionante diccionario en doce tomos y dos apéndices, así como a la editorial barcelonesa Montaner y Simón, que acabó por comprar en 1952. Sin embargo, sus inicios son igualmente interesantes y permiten trazar una trayectoria basada en la internacionalización de su trabajo y sobre todo en el interés por las grandes enciclopedias presentadas con esmero y de encuadernación lujosa, comercializadas a plazos para hacerlas así asequibles a casi todos los bolsillos.

Horace Everett Hooper.

A su llegada a Cuba desde su Galicia natal, uno de sus primeros empleos que tuvo fue como dependiente en una librería de viejo, pero poco después pasó a ser vendedor de la celebérrima Editorial Jackson, cuya fama se debe sobre todo a sus grandes enciclopedias vendidas a crédito y cuyos orígenes se encuentran en la historia del editor estadounidense Walter Montgomery Jackson (1863-1923), que había empezado como librero pero se hizo famoso cuando, asociado con Horace Everett Hooper (1859-1922), compró los derechos de la Enciclopedia Británica, de manos de A. & C. Black, y juntos pusieron todos sus esfuerzos en la implantación de la magna obra editorial en Estados Unidos apoyándose en el famoso publicista Henry Haxton. Además, se ocuparon de la undécima edición, dirigida por Hugh Chisholm desde Londres y Franklin Hooper (hermano de Horace) en Estados Unidos, que tiene la peculiaridad de contener un artículo («advertisement», cómo no) redactado por el mencionado publicista. Sin embargo, Jackson parecía más interesado en seguir publicando versiones revisadas y actualizadas que en hacer una auténtica nueva edición, y parece que algo de ello tuvo que ver en que acabara por romper la asociación –con el consiguiente conflicto– y emprendiera una andadura por su cuenta que se concretó en la creación de lo que llegaría a ser otro gigante de la edición de enciclopedias: Grolier (que debe su nombre al conocido bibliófilo Jean Grolier de Servières, 1489-1565).

La Grolier Society, haciendo honor a su nombre, se centró inicialmente sobre todo en una línea de libros lujosos con textos de autores clásicos y más o menos raros, pero más adelante la compra en 1908 de los derechos de The Children Eciclopaedya (creada por el escritor Arthur Mee, 1875-1943) le permitió unas mayores ventas gracias a un tipo de enciclopedias y grandes obras temáticas destinadas al público infantil y sobre todo juvenil, a las que bautizó como The Book of Knowledge.

Edición bonaerese en la Editorial Jackson de Ediciones Selectas de la obra Neil Paterson Pasó una estrella.

Después de expandirse como editorial Jackson Ediciones Selectas, la empresa creada por el audaz estadounidense en las primeras décadas del siglo, experimentó un enorme crecimiento y una expansión que la llevó a abrir sucursales en la mayoría de países americanos (Argentina, Perú, Uruguay, Brasil, Colombia, Cuba…), donde implantó con notable éxito el sistema de venta a crédito.

De todos modos, tampoco en la Editorial Jackson duró muchos años González Porto, pese a ser uno de sus vendedores más exitosos, hasta el punto que el propio Jackson le recomendó que se tomara unos meses de descanso y regresara a España. No fue buena idea, porque en cuanto llegó a la Península tuvo que incorporarse al servicio militar (por entonces obligatorio). En cuanto estuvo en condiciones de volver a Cuba pudo retomar su empleo en Jackson, pero pronto se estableció como «importador de libros y agente de editores extranjeros» –entre los que se encontraban, por ejemplo, Montaner y Simón–, en su establecimiento de la calle Obispo (núm. 409), entre Compostela y Aguacate, inicialmente asociado con su hermano Francisco en la Librería Académica, y posteriormente como Editorial González Porto, que pronto cuenta con una sucursal en Caracas (dirigida por su hermano Hipólito), mientras que otro de sus dieciocho [no es errata] hermanos, Manuel, se ocupa de la sede habanera.

Muy probablemente con el modelo de las Jackson en mente, en 1928 González Porto ideó y desarrolló el proyecto de una magna obra en 25 volúmenes de 400 páginas cada uno y muy profusamente ilustrado, El libro de la cultura, que propuso a la también barcelonesa Salvat (en concreto a Fernando y Santiago Salvat Espasa), que la acogieron con indudable interés y pronto establecieron un acuerdo. Tardó unos años en hacerse realidad, pero en 1933 se retoma la idea, relaborada, y González Porto empieza a buscar colaboradores para la versión americana en Cuba, Puerto Rico, Jamaica, Santo Domingo, México, Guatemala, Honduras, Costa Rica, El Salvador, Nicaragua, Panamá, Colombia, Venezuela, cuya unificación encomienda al escritor hondureño establecido en México Rafael Heliodoro Valle (1891-1959), quien se desespera un poco con la escasa disciplina de los redactores españoles con respecto a las normas que se habían establecido. A principios de 1935 empieza a promocionarse esta imponente obra, con el objetivo de poder continuar financiándola mediante la venta de los primeros siete volúmenes impresos hasta entonces, y González Porto viaja a Europa para, además de contratar la exclusiva de distribución de nuevas obras españolas, intentar vender los derechos de traducción de su gran proyecto a otras lenguas (particularmente al italiano). Sin embargo, el estallido de la guerra civil española frustra estas expectativas, y en septiembre de 1936 González Porto regresa a Cuba, desde donde se establece luego en México (donde ya anteriormente había residido seis meses comisionado por Jackson) y donde funda ya en 1938 la Unión de Tipógrafos Editorial Hispano Americana, dejando el local cubano como una sucursal especializada en libros de literatura, arte, enciclopedias y diccionarios.

Manuel Andújar.

Como es bien sabido, porque se reitera en cualquier análisis que se haya hecho de ella, la situación política de aquellos años favoreció en buena medida el crecimiento de las editoriales en América, principalmente por el estado de postración en que quedó la industria española como consecuencia de la guerra y, a la conclusión de la misma, como consecuencia de su resultado y del periodo tanto económico como político que entonces se abrió en España. A las duras limitaciones en la compra de papel, la dificultad –prácticamente imposibilidad– de modernizar la maquinaria y los procesos de trabajo al ritmo que lo estaban haciendo las empresas más competitivas y la escasez de profesionales cualificados o con experiencia, debía añadirse además el peso de la censura religiosa y política, que propiciaba que los autores y editoriales extranjeros que pretendían que sus obras fueran traducidas al español optaran por hacerlo a través de empresas americanas. Y a ello hay que añadir aún el enorme flujo de escritores y profesionales expertos tanto en labores de edición como de impresión y encuadernación, que no hizo otra cosa que propiciar un auge de la edición sobre todo en México y Argentina, que fueron los dos países que más refugiados republicanos acogieron y donde más oportunidades tuvieron de retomar de alguna manera sus carreras profesionales.

Así pues, la editorial González Porto continuó como editorial dentro del conglomerado que fue creándose alrededor de UTEHA con la creación en 1946 de la editorial Acrópolis (con sede también en Caracas), además de contar con sus propias y muy pronto potentes imprenta y distribuidora. El crecimiento y expansión de la editorial en los años sucesivos y la nómina de colaboradores que UTEHA conseguirá para la elaboración de su famoso diccionario es impresionante y constituye una retahíla de nombres ilustres, pero valga como ejemplo recordar, limitándonos exclusivamente a los refugiados españoles, que durante quince meses tuvo como representante en Chile al excelente escritor Manuel Andújar (1913-1994), que procedía del mexicano Fondo de Cultura Económica; o que tuvo como gerente apoderado al economista y sindicalista Estanislau Ruiz Ponsetí (1889-1967) cuando éste abandonó la editorial Atlante de Juan Grijalbo (1911-2002), y a su vez fue sustituido por otro español, Julio Sanz Saínz; como editor al cenetista Marín Civera Martínez (1900-1975), que en la península Ibérica había dirigido los periódicos Orto, El Pueblo y Mañana; como ilustrador a Pere Calders (1912-1994), que en México también había trabajado mucho para Atlante; como corrector de pruebas al tipógrafo Manuel Albar Catalán (190-1955), y haciendo diversas labores, muchas de ellas vinculadas a la Enciclopedia UTEHA y a la Enciclopedia Cultural UTEHA, a Antonio Ramos Espinós (que dirigió el departamento de enciclopedias y diccionarios), Luis Doporto Marcheri (que llegó a ser director del departamente editorial, tras una larga carrera en la casa);  Gabriel García Narezo (n. 1916), por no mencionar a la pléyade de redactores de este tipo de obras que hicieron famosa a la editorial, entre ellos el historiador Josep M. Miquel i Vergés (1903-1964) y  la química María Teresa Toral (1911-1994) o a la extensísima nómina de traductores e ilustradores de relumbrón de origen español, que incluiría nombres como Agustí Cabruja (1908-1983), Lluis Ferran de Pol (1911-1995), Albert Folch i Pi (1905-1993), Miquel Santaló (1888-1961), Josep Maria Giménez Botey…

Esto permitió escribir con razón al pontevedrés Julio Sanz Saínz (que tras su paso por Labor Mexicana sustituyó a Ruiz Ponsetí como gerente y más tarde fundaría la editorial Aconcagua), en El exiliado vive en las honduras de su ser:

En la capital mexicana se editó, y fue obra de los refugiados españoles, el único diccionario enciclopédico, originalmente redactado en Hispanoamérica, no traducido de otros idiomas, que incluía todo núcleo de población de habla hispana con más de cien habitantes; el diccionario cubrió el vacío de obras similares editadas, escritas o sólo traducidas en España; subsanó matices, errores y omisiones producidos por el predominante criterio del virreinato y del espíritu centralista absorbente de la metrópoli.

Fuentes:

Manuel Aznar Soler y José-Ramón López García, eds., Diccionario biobliográfico de los escritores, editoriales y revistas del exilio republicano de 1939, Sevilla, Renacimiento (Biblioteca del Exilio), 2006.

Carlos Bua, «Memorias de un cubano. El gato de papel», 2 de junio de 2014.

Philippe Castellano, «El libro de la cultura o cómo se intentó construir una representación de América Latina», Cahiers du CRICCAL, vol. 31, núm. 1 (2004), pp. 73-80.

Marcela Lucci, Semblanzas de José María González Porto y de la Unión Tipográfica Editorial Hispano Americana en el portal Editores y Editoriales Iberoamericanos (siglos XIX-XX) – EDI-RED.

Julio Sanz Sainz, El exiliado vive en las honduras de su ser, Valls, edición del autor al cuidado de Eduardo Fermín Partido e impresa en Gràfiques Moncunill, 1995.

Moulines, un librero y editor excepcional

Al término de la guerra civil española, Venezuela fue país de acogida de muchos refugiados republicanos víctimas de la guerra civil española, entre los que suelen destacarse sobre todo a una pléyade de científicos: Manuel Corachán (1881-1942), que fundó en la Universidad de Caracas el Instituto de Cirugía Experimental; August Pi i Sunyer (1879-1965), que impartió diversas materias en la Universidad Central y dirigió el mencionado Instituto de Medicina Experimental; Rossend Carrasco i Formiguera (1892-1990), profesor de fisiología sucesivamente en las universidades de Los Andes (Mérida), Maracay y Central de Caracas; el valeroso Antoni Peyrí (1889-1973), que dirigió la leprosería Isla de Providencia de Maracaibo, o el geógrafo Pau Vila i Vinarès (1881-1980), que desarrolló una ingente y fructífera labor docente, y a éstos podrían añadirse muchos otros. Sin embargo, también hubo entre los exiliados republicanos que fueron a parar a Venezuela alguna gente del libro importante, como es el caso del librero y editor Linus (o Lino) Moulines Gascons (1913-2000).

Pere Pagès i Elies (Victor Alba).

Su compañero de militancia en el BOC (Bloc Obrer i Camperol) Víctor Alba describe de un brochazo al Moulines de principios de los años treinta, en Barcelona, «despechugado y con sandalias», y lo recuerda como quien le descubrió un restaurante de la calle Sitjà donde por 1,25 pesetas diarias los estudiantes podían hacer una comida a mediodía y tomarse un café con leche como cena. Moulines había llegado a Barcelona en 1933 procedente de su Anglès (Girona) natal –tras un breve paso por Terrassa, donde trabajó en la industria textil– con el propósito de presentarse a una oposición convocada por el SMC (Sindicat de Metges de Catalunya), y, según el Diccionario biobibliográfico del exilio republicano de 1939, en esos años se ocupó de la edición de «revistas y folletos de carácter médico-científico» cuyos títulos no precisa.

Al estallar la guerra, este militante del BOC y luego del POUM (Partit Obrer d’Unificació Marxista) participó en la toma de la universidad y posteriormente marchó al frente de Aragón, hasta que el 10 de febrero de 1939 cruzó la frontera con Francia, donde pasó por varios campos de concentración antes de poder evadirse a Luxemburgo. Allí fue detenido por indocumentado y enviado a un campo de trabajo en el Sarre. La que sería su esposa, Otília Castellví (1917-2001), dejó un testimonio impagable e imprescindible para reconstruir estos años del primer exilio –o primera etapa del exilio– en De las checas de Barcelona a la Alemania nazi. Veinte años de una vida (Acantilado, 2008).

Con su llegada en 1946 a Brasil, país desde el que antes de un año pasaría a Venezuela, se abría una nueva etapa en la trayectoria de Moulines en la que una de los primeros hitos fue convertirse ese mismo 1946 en primer secretario de la Asociación Esperantista. La librería Suma, de la que Moulines fue gerente, no tardó en convertirse en uno de los puntos de reunión y difusión de esta lengua, en la que el propio librero tuvo un papel muy destacado como conferenciante y articulista. La dedicación de Moulines a su labor como librero fue lo que le convirtió con el tiempo en un punto de referencia indispensable, y a principios de la década de los cincuenta ya estaba al frente de otra librería, la Politécnica (en la caraqueña calle Villaflor, de Sabana Grande), que se convirtió en agente de ventas de las publicaciones de la Unesco y de la FAO y que, además de mantener contacto frecuente con editores españoles, proveía de material bibliográfico a lo más granado del país. Cuenta su esposa que «Linus se pasaba todo el día en la librería. La élite profesional y política de Caracas iba a comprar sus libros a la librería». Su fluida y frecuente relación con los ambientes universitarios le convirtió además en asesor y proveedor de los más importantes profesores e instituciones culturales (como es el caso por ejemplo del Centro Cultural y de Estudios Sociales), y facilitó también las colaboraciones editoriales. La Politécnica fue además la librería en exclusiva de la facultad de Agronomía de la Universidad Central de Venezuela, así como de otras varias de la Universidad Católica Andrés Bello, y más adelante coeditó algunas obras con el Instituto Nacional de Cultura y Bellas Artes (unas Novelas ejemplares de Cervantes en 1969, por ejemplo) o la Academia Nacional de la Historia entre otras instituciones.

Al mismo tiempo, en 1953, como miembro del Centre Català de Caracas –en cuya revista Senyera dejó algunas colaboraciones–, participó activamente en la organización de los Jocs Florals de la Llengua Catalana de ese año, celebrados en el Teatro Municipal de Caracas y en el que, por conseguir por tercera vez la Englantina, se proclamó al poeta Agustí Bartra (1908-1992) mestre en gai saber.

Guillermo Meneses.

La firma de Linus Moulines aparece junto a las de Macario Fernández, Jaime Gelpi Lago, Alfredo León Luprón, José Ramón Martín, José María Pachón, Gerónimo Puig Pérez, José Rivas Rivas, Violeta Roffe, Julio Vázquez, Luis Yépez en el acta de constitución de la Cámara Venezolana del Libro, fechada el 7 de noviembre de 1953, y unos pocos años anteriores (¿1950?) son las primeras ediciones de la empresa que Moulines acababa de crear, la editorial Nueva Cádiz, que arrancó con un Atlas escolar de Venezuela (1951)  y con la ambiciosa colección Biblioteca de Escritores Venezolanos, donde recuperó varios títulos de Manuel Díaz Rodríguez (1871-1927) (Sensaciones de viajes, Confidencias de psiquis prologadas por Pedro Emilio Coll, Cuentos de color, Camino de perfección y otros ensayos) e hizo una segunda edición de la obra del cronista y tipógrafo venezolano Casto Fulgencio López (1893-1962), Lope de Aguirre, el Peregrino, primer caudillo de América, así como La voz de los cuatro vientos (poemas), de Fernando Paz Castillo (18931971),  El falso cuaderno de Narciso Espejo, de Guillermo Meneses (1911-1978), Humanismo y romanticismo, de Luis Beltrán Guerrero (1914-1996), Juan Bautista Picornell y la conspiración de Gual y España. Narración documentada de la pre-revolución de independencia venezolana, también de Casto Fulgencio López, y, en 1955, un Compendio histórico de la literatura de Venezuela preparado por el abogado y político José Ramón Barrios Mora (1913-¿?).

Una cuestión que no he podido esclarecer es a qué responde el hecho de que el pie de estas ediciones indique Caracas (Venezuela)-Barcelona (España) como lugar de publicación, pero quizá la estrecha relación entre Moulines y el editor, escritor y traductor catalán de Terrasa Ferran Canyameres (1898-1964), con quien había coincidido también en Francia, sea una posible vía de explicación. Canyamares, que había regresado a Barcelona en 1949, se encontraba en una situación financiera bastante complicada pese a contar con los derechos de traducción y edición de las obras de George Simenon, y sobre todo después de haber sido detenido y encarcelado entre 1951 y 1955, por lo cual a finales de 1955, según su biógrafo Gustau Erill i Pinyot, «intenta colocar libros sobre todo a los amigos de Sudamérica, como Linus Moulines, de Venezuela, que es librero, y Emili Pla, en el mismo país, a quien propone entrar como socio en la editorial [Albor] y le pide que haga de mediador con otras editoriales y distribuidores». Y durante el año siguiente:

Llegó a ser tan mala la situación de la editorial que suerte tuvieron de la ayuda que les llegaba de Venezuela. Pla y Moulines les mandaban cada mes mil quinientas pesetas (que Canyameres tuvo que pedir que mandaran a nombre de Fernando Cañameras porque si no no las podía cobrar en Correos), teóricamente a cuenta de libros del fondo de Aymà. Libros que, por otra parte, muy probablemente Linus Moulines tampoco vendía con la fluidez suficiente para justificar mensualmente ese dinero, y mucho menos Emili Pla, que no tenía ningún negocio directamente relacionado con el mundo del libro.

Aun sin la más mínima prueba, ¿se puede especular que quizá, desde el momento de su regreso a la península, Canyameres colaboraba de algún modo en las ediciones de Nueva Cádiz? El epistolario entre Moulines y Canyameres refleja la voluntad del primero de regresar a Barcelona y crear una librería especializada en libros técnicos como la que tan bien le funcionaba en Caracas, mientras que el segundo tenía arrendados los bajos de una torre en Vallcarca (donde guardaba los libros de Simenon del fondo Aymà) que quizá le podría convenir a su amigo, pero antes de poder concretar nada, Canyameres se quedó sin local (y consiguió que una fábrica de Terrassa le cediera un rincón donde dejar los libros).

Portada de una edición Nueva Cádiz con el doble pie.

En el verano de 1958, tras un nuevo paso por prisión, Canyameres consiguió llegar a un acuerdopara alquilar la parte del piso donde había estado la editorial Albor a Moulines y Otilia Castellví (que lo aprovecharían en las temporadas que pasaran en la capital catalana) y además se convirtió en representante en Barcelona de la empresa de su amigo. Explica Erill i Pinyot:

Sin serlo legalmente, ni con una remuneración específica, Canyameres salía a hacer gestiones y encargos a las editoriales y librerías de Barcelona por cuenta de su amigo: era un modo de devolverle el gran favor económico que desde Venezuela les había hecho, y todavía les estaba haciendo, desde que se encontraban en aquella situación.

Unos años después, en junio de 1963, el matrimonio Moulines pasó en compañía de su amigo una semana de reposo en el monasterio de Montserrat, que Canyameres aprovechó para proseguir con la escritura de su propia obra literaria. Por su parte, Moulines, que participaría también en la organización de los Jocs Florals de 1966 en Caracas, presididos por Rómulo Gallegos (1884-1969), obtendría un importante éxito unos años después con una recopilación del argot caraqueño, que firmó como Julio Cáceres y publicó en 1974 en Nueva Cádiz, Malas y peores palabras.

Ferran Canyameres.

Más allá de las diversas facetas profesionales de Moulines Gascons (esperantista, librero y difusor de la cultura y el conocimiento, editor de literatura y de bibliografía científica y académica, etc.), una primera aproximación panorámica ya permite entrever una calidad humana excepcional, que viene a confirmar la que ofrecen las memorias de su esposa, recomendables sin reparos.

Fuentes:

Esther Barachina, «Lino Moulines Gascons», en Manuel Aznar Soler y José Ramón López García, eds., Diccionario biobibliográfico de los escritores, editoriales y revistas del exilio republicano de 1939, Sevilla, Gexel-Renacimiento, 2017, vol. 3, p. 372.

Otilia Castellví, De las checas de Barcelona a la Alemania nazi: veinte años de una vida, Barcelona, Acantilado, 2008. Hay una versión previa (1997), también en español, en la editorial Oikos-Tau y el título 1926-1946: Vint anys d’història

Gustau Erill i Pinyot, Ferran Canyameres. Entre la memòria i l´oblit, Barcelona, Baula, 1999.

Lino Moulines, «Orígenes o inicios del esperanto en Venezuela», conferencia reproducida en el blog de Ricardo Coutinho el 10 de junio de 2011.

Precedentes del primer gran grupo editorial español (la CIAP).

logociapsEntre los últimos años de la década de los veinte y los primeros de la siguiente, la Compañía Ibero Americana de Publicaciones se constituyó en el primer gran grupo editorial mediante la voraz compra de cabeceras de revistas (La Gaceta Literaria), editoriales (Renacimiento, Mundo Latino, Ediciones Atlántida, Hoy, Mercurio, Estrella), librerías (la Librería Fe y sus diez subsidiarias) e incluso creó grandes imprentas y talleres, así como con el diseño de una enorme red de distribución de todo tipo de material impreso, que además obtuvo en exclusiva la distribución de editoriales de avanzada pujantes como Zeus, Ulises o Signo. Es evidente que la Compañía Anónima de Librería, Publicaciones y Ediciones (Calpe), creada en 1918 por Papelera Española, se puede considerar un intento más sostenido de crecimiento en la misma dirección, pero en la base de la CIAP, con una política más agresiva (y apresurada), se encontraba una curiosa empresa puesta en pie por un audaz periodista e historiador jerezano Manuel L.[uis] Ortega Pichardo (1888-1943).

Con apenas veintiún años, Ortega Pichardo empieza a actuar ya en 1909 como director de una cabecera aún hoy en activo, el Diario de Jerez, periódico creado por los hermanos José y Federico Joly Höhr, y poco después publicaba una primera compilación de críticas políticas y literarias con el título Frivolidades (1910), a la que seguiría el año siguiente otra de artículos costumbristas, El amor y la vicaría, películas de cine (Diario de Jerez, 1911) y más adelante La vida que pasa (Empresa Editora Andalucía, 1916). En los años siguientes, además de cubrir como corresponsal la conocida como Guerra del Rif, dejaría una estela de diarios y publicaciones periódicas, pero quizá una de las más interesantes en relación a la CIAP sea la Revista de la Raza. Publicación de Estudios Internacionales (1915-1930), creada en colaboración con Ignacio Bauer Landauer, hijo (y heredero) del banquero Gustavo Bauer Morpurgo (1865-1916), representante a su vez de los Rothschild en España.

ortegapichardo

Manuel L. Ortega Pichardo.

Entre algunas de las curiosidad que a lo largo de su historia publicó la Revista de la Raza, se cuenta una breve obra narrativa titulada «En los tentáculos de los siglos» y firmada con el seudónimo Isabel Inghirami, que es el que empleaba al principio la escritora María Teresa León (10903-1988) (número 119, febrero de 1925, pp. 18-19), o también diversos artículos de la escritora y periodista Carmen de Burgos (1867-1932), en ambos casos ya a principios de los años veinte. A partir precisamente de 1924 esta cabecera se convertiría en la portavoz de la Liga Internacional de Mujeres Ibéricas e Hispanoamericanas, y serían frecuentes en sus páginas las firmas de Ana de Castro Osorio (1872-1935), Emilia de Sousa Costa, (1877-1959), Micaela Díaz Rabaneda (1827-1931), Elena de Arizmendi (1884-1949), María de La Rigada, Nurie Gabay de Estrugo, etc.

logoiberoafroSin embargo, antes de acabar la segunda década del siglo XX, Ortega Pichardo había creado una Editorial Ibero-Africano-Americana que, por lo menos desde 1917, se había ocupado de publicar en Marruecos unos anuarios que se presentaban como la «guía oficial de Marruecos», y en esa misma fecha aparece en una Colección Hispano-Marroquí de la misma editorial España en Marruecos: el Raisuni, firmada por el propio Ortega Pichardo. Al año siguiente aparecía en la misma colección e impreso en la Tipografía Moderna el que sin duda es el título más conocido del prolífico Ortega Pichardo, Los hebreos en Marruecos. Estudio histórico, político y social, que en la primera edición incorporaba un prólogo del alto comisario de España en Marruecos Francisco Gómez Jordana (1852-1918) y que tuvo diversas reediciones (CIAP, 1929, con prólogo de Pedro Sáinz y Rodríguez; reimpreso en la Ediciones Nuestra Raza, 1934) antes de que en 1994 la reeditara Algazara con prólogo del historiador Víctor Morales Lezcano.

Por esos mismos años parece que la editorial va cobrando envergadura, quizás gracias a la colaboración de Ignacio Bauer. Así, en 1920 se publica una edición de El Diablo Mundo, de José de Espronceda, acompañado de un juicio crítico del hispanista escocés James Fritzmaurice-Kelly (1858-1923); en 1922, una biografía del por entonces aún vivo doctor y senador vitalicio Ángel Pulido Fernández (1852-1932) Figuras Ibéricas, escrita por Ortega Pichardo y prologada por Ignacio Bauer, que aparece en una Biblioteca Hispano-Sefardí, y también de 1922 son tres libros preparados por Ignacio Bauer: los seis volúmenes recopilatorios de las Relaciones de África, los Apuntes para una bibliografía de Marruecos y la Carta de Roma. Don Juan de Zúñiga a Felipe II (1577); de 1923 son los Apuntes para la historia de las cofradías musulmanas del arabista y diplomático Clemente Cerdeira Fernández (1887-1942), y del año siguiente El convidado de piedra, de Tirso de Molina, que ejemplifica una de las derivas que empieza a tomar ya la editorial en esos años, la publicación de obras clásicas españolas.

sainzrodriguez

Pedro Sainz Rodríguez.

En noviembre de 1924 se produce un acontecimiento que lo cambia todo: la constitución de la CIAP (que se escritura ante notario el 28 de enero de 1925). Entre sus fundadores, Ignacio Bauer Landauer (presidente), José Francos Rodríguez, Antonio Goicoechea y Alberto Bandelac de Pariente (como vicepresidentes), Manuel Luis Ortega Pichard (como consejero delegado y director gerente), Pedro Sainz Rodríguez, (consejero y director literario) e Isaac Toledano, José Arango, Rodrigo Saavedra Vinent, Ángel Arpón de Mendívil, Carlos E. Montañés, Menhakent Coriat y Jacques Bentata como consejeros.

En un muy detallado y completo artículo acerca de la trayectoria de la CIAP, Miguel Á. López-Morell y Alfredo Molina Abril hacen una perfilada caracterización de este grupo fundacional y de las consecuencias del mismo:

En el primer Consejo de Administración y en sus posteriores incorporaciones destacó, como ha mostrado Molina, un significativo grupo de personas vinculadas a la comunidad judía norteafricana, como Toledano, Coriat o Bandelac, junto a personalidades importantes de la vida cultural madrileña, como los exministros Goicoechea y Francos Rodríguez, presidente este último de la Asociación de la Prensa, o los catedráticos universitarios [Rafael] Altamira y Sainz Rodríguez, interesados también en las relaciones con la comunidad judía o en el estudio de la influencia cultural hebrea, lo que reportaría a la institución algunas críticas de sectores filorracistas y ultraconservadores en los años siguientes.

perraultAun así, parece ser que la Editorial Ibero-Africano-Americana siguió una trayectoria más o menos paralela pero independiente a la de la CIAP, sin integrarse a ella, y en los años siguientes continuaron apareciendo títulos bajo ese sello, entre los que se cuentan, por ejemplo, una traducción de Agustín Aguilar de La vida amorosa de Luis XIV (1926), de Louis Bertrand (186-1941), en una colección llamada Los Amores, donde se publica también una traducción de Rafael de Morales de La vida amorosa de Casanova (1926), de Maurice Rostand; una traducción no firmada de los Cuentos de viejas (1928) de Charles Perrault prologada por Ignacio Bauer con la que se estrenaba una colección de Las Cien Mejores Obras de la Literatura Universal, que tenía también una equivalente en Las Cien Mejores Obras de la Literatura Española, donde se publica un Lazarillo (1927) prologado por uno de los historiadores que colaboraban asiduamente en la Revista de la Raza, Rodolfo Gil Benumeya (1901-1975) o, incluso una vez ya desmembrada la CIAP, una monumental Colección de documentos inéditos para la historia de Ibero América, 1927-1932 publicada en catorce volúmenes en 1934 bajo la dirección de Rafael Altamira, que no había tardado en entrar en el consejo de administración de la CIAP.

wallacenuestrarazaDe todos modos, el momento que suele señalarse como el arranque de la expansión de la CIAP, el año 1928, va precedido de una cesión de relativa importancia, por lo menos por las consecuencias que tiene en las cabeceras que se ven afectadas por ella. En los últimos meses de 1927, Ortega Pichardo cede a la CIAP, junto a la Guía de Balnearios y Casas de Descanso de España, la Revista de la Raza, en la que por esos tiempos la sección «Mundo Sefardí» ocupaba un tercio de la revista y en la que colaboraba con más o menos asiduidad, Alejandro Lerroux, Niceto Alcalá-Zamora o José Antonio de Sangróniz.

Durante la etapa de expansión de la CIAP, además de la Revista de la Raza, tiene continuidad pues la Editorial Ibero-Africana-Americana, e incluso  una vez que la CIAP se empieza a saldar el stock en 1931 siguen apareciendo algunos títulos, cabe suponer que debido a que Ortega Pichardo mantuvo la propiedad del sello sin vincularlo a la CIAP. Por otra parte, en unas llamadas Ediciones Nuestra Raza aparece, por ejemplo, la edición ya mencionada de Los hebreos en Marruecos prologada por Sainz Rodríguez en 1934, o al año siguiente el Maimónides, un sabio de la Edad Media, de Ignacio Bauer, en una colección llamada Los Hombres de Nuestra Raza, y Las pinturas negras de Goya, del crítico literario y por entonces patrono del Museo Municipal de Madrid Emiliano M.[artín]. Aguilera (1905-1975), así como El Zohar en la España musulmana y cristiana, de Ariel Bension (1880-1932), con prólogo de Miguel de Unamuno (1864-1936), o textos que previamente habían aparecido en la Biblioteca Cervantes de la CIAP, como una edición de La Política de Aristóteles, las Doloras, poemas y humoradas, de Ramón de Campoamor, seleccionadas por Agustín Aguilar, o los dos tomos de la Historia de los movimientos, separación y guerra de Cataluña, que el escritor y militar portugués Francisco Manuel de Melo (1608-1666) había firmado como Clemente Libertino.

nuestrarazaPor el camino, Ortega Pichard había creado diversas publicaciones periódicas (El Heraldo de Marruecos en Larache y el ceutí Mediterráneo, ambos en 1925), y posteriormente, durante la guerra civil, como conocido monárquico, fue objeto de persecución, encarcelamiento, enviudó en 1938 y se refugió en la embajada de Finlandia. Esteban Salazar Chapela, que trabajó unos años en la CIAP y a quien Ortega Pichard había presentado a Unamuno, ofrece la siguiente explicación de cómo se salvó el editor jerezano en su novela en clave En aquella Valencia:

–Socorrito y yo –le dije a Palomino– trabajamos juntos unos años en la editorial Carabela [CIAP]…

–Hombre, la Carabela –contestó Palomino–. El gerente de esa editorial, don Manuel Picazo [Ortega Pichardo], estuvo si lo pasean o no lo pasean. Se salvó por chiripa, no sé si usted lo sabe.

–No he sabido nada de él desde mucho antes de la guerra.

–Sí, estuvo en capilla y lo sacó de allí ese escritor de teatro… ¿cómo se llama?, ese escritor que estrenó dos obras que hicieron mucho ruido, Santa Isabel de Ceres, Los gorriones del Prado…

– [Alfons] Vidal y Planas.

–Ése. Él me lo contó pocos días antes de venirme a Valencia. Desde su prisión, donde ya llevaba dos días, don Manuel consiguió enviarle unas líneas a Vidal y Planas. Este Vidal es un anarquista de lo más sentimental, bondadoso y puro que puede darse.

[…]

Como les decía, Vidal recibió las líneas, corrió al sitio donde tenían metido a don Manuel y preguntó a sus correligionarios, pues todos eran allí anarquistas: «¿Y por qué lo vais a matar? Este hombre no se ha metido en nada ni es peligro ninguno para la causa» «Pero sabemos (le explicaron) es un inmoral…». Lo iban a matar por inmoral. La réplica de Vidal fue muy buena: «Compañeros, si vamos a matar en España a todos los inmorales no quedaremos nadie para contarlo». El razonamiento surtió efecto y le dieron el preso.

nraza

La carabela que aparece tanto en el logo de la CIAP como en el de las Ediciones Nuestra Raza sirve a Salazar Chapela para asignar el nombre en clave a la editorial en su novela.

Casado en segundas nupcias con la hija de un militar, Mery del Olmo, Ortega Pichardo moriría apenas cuatro años después del final de la guerra.

Fuentes:

eslabonLuisa Carnés, El eslabón perdido, edición de Antonio Plaza Plaza, Sevilla, Renacimiento (Biblioteca del Exilio 9), 2002.

Francisco Fuster García, «Compañía Ibero Americana de Publicaciones (CIAP)», en Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIX-XXI) – EDI-RED.

José Luis Jiménez García, «El periodista jerezano Manuel Luis Ortega Pichardo, autor del libro Los hebreos en Marruecos», Tarbur Sefarad, 10 de agosto de 2010.

Miguel Ángel López-Morell y Alfredo Molina Abril, «La Compañía Iberoamericana de Publicaciones, primera gran corporación editorial en castellano», Revista de Historia Industrial, núm. 49 (febrero de 2012), pp. 111- 145.

Jesús A. Martínez Martín, dir., Historia de la Edición en España, 1836-1936, Madrid, Marcial Pons, 2001.

enaquellavalenciaFrancisca Montiel Rayo, Esteban Salazar Chapela en su época: obra literaria y periodística (1923-1939), tesis doctoral leída en la Universitat Autònoma de Barcelona en 2005.

Francisca Montiel Rayo, «Esteban Salazar Chapela (Málaga, 190- Londres, 1965)», en Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIX-XXI) – EDI-RED.

Julio Saez Angulo y Dolores Gallardo, «Manuel Luis Ortega Pichardo, periodista, escritor y editor de la CIAP», La Mirada Actual, 23 de enero de 2011.

Esteban Salazar Chapela, En aquella Valencia, edición de Francisca Montiel Rayo, Sevilla, Renacimiento (Biblioteca del Exilio 4), 2001.

 

La Editorial Rocas y el «descubrimiento» de Vargas Llosa

vargasllosajovenEl descubrimiento de Mario Vargas Llosa (n. 1936) ha quedado comúnmente asociado a la obtención del Premio Biblioteca Breve en 1962 con La ciudad y los perros (1962), que luego ganaría también el Premio de la Crítica, y a la labor de difusión que de su obra llevaron a cabo con tesón la agente Carmen Balcells (1930-2015) y el editor Carlos Barral (1928-1989).

Sin embargo, quienes por primera vez le permitieron entrever la posibilidad de acabar convirtiéndose en escritor profesional fueron los editores de la barcelonesa Editorial Rocas, que por aquel entonces estaba consiguiendo prestigiar un galardón destinado a libros de cuentos literarios, el Premio Leopoldo Alas, mediante el cual esta singular empresa se estaba haciendo con un cierto renombre entre las jóvenes promesas del género. La idea surgió de un grupo de curiosos escritores vinculados muchos de ellos profesionalmente a la medicina: el especialista en obstetricia y ginecología Martín Garriga Roca (1900-1980); el estomatólogo Esteve Padrós de Palacios (1925-2005), que se había iniciado como ayudante de Garriga en la asistencia a partos a domicilio, el también ginecólogo Manuel Carreras Roca (1915-1997), quien antes de la guerra se financió los estudios como futbolista del Llevant y el València, y el crítico literario y poeta Enrique Badosa. A Badosa y Padrós atribuyó específicamente Vargas Llosa la posibilidad de publicar su primer libro, y en realidad la Editorial Rocas, y muy particularmente la Colección Leopoldo Alas, de cuentos, dio a conocer algunos otros nombres importantes o apoyó de un modo decisivo a jóvenes narradores que no tardarían en destacar en la segunda mitad del siglo XX.

12cuentos

La mencionada colección se había estrenado en 1956 con 12 cuentos y 1 más, con el que se da a conocer Lauro Olmo (1921-1994), quien sin embargo ya había publicado en colaboración con Pilar Enciso (1919-2000) El león engañado y Cuno (en la colección Literatura de Juglaría, Madrid, Gráficas Bachende) y el poemario Del aire (en la colección Neblí que dirigían Rafael Millán y Felipe García Ibáñez) y quien poco después se ganaría un lugar destacado en la historia de la literatura española en el terreno de la literatura dramática (La camisa, 1960; La pechuga de la sardina, 1962; English Spoken, 1967, etc.). Entre las curiosidades de este volumen se cuenta un muy buen prólogo de Enrique Badosa y la indicación de la barcelonesa calle Ausias March, número 31 (esquina calle Girona), como sede de la editorial, pues coincide con el domicilio de la clínica en la que trabajaban Esteve Padrós y su hermano Eduard, y donde previamente había tenido la suya su padre, el oftalmólogo Jaume Padrós de Gaona (1885-1943). Según reza en la página 5 de este volumen, impreso en Socitra y encuadernado en rústica:

Doce cuentos y uno más, de Lauro Olmo, fue galardonado con el I Premio Leopoldo Alas para libros de cuentos literarios en Barcelona la noche del día 3 de marzo de 1956, por un jurado compuesto por don Martín Garriga, don Manuel Carreras, don Gonzalo Lloveras, don Manuel Pla y Salat, don Miguel Dalmau Ciria, don Juan Planas Cerdá, don Esteban Padrós de Palacios y don Enrique Badosa.

lauroolmo

La familia Olmo al ser deshauciados de Las Pozas en noviembre de 1972.

No deja de tener su interés y su punto subversivo la reivindicación del escritor Leopoldo Alas (1852-1901) implícita en el nombre elegido para el premio y la colección, pues vale la pena recordar que la obra magna de este autor, la novela La Regenta, estuvo prohibida por la censura franquista durante muchos años, y justo por aquel entonces, ese mismo año 1956, al editor Alfredo Herrero Romero (1924-1974) se le denegó la autorización de publicarla alegando en el informe de censura que «los verdaderos protagonistas de la obra son la simonía y la lujuria, que convierten un bellísimo idilio digno de Santa Teresa o San Juan de la Cruz en un torbellino de lascivias sacrílegas».

El tercer número de la colección Leopoldo Alas (el segundo es una antología de cuentos presentados al premio) lo ocupó en 1957 un libro de quien obtuvo el premio homónimo en su segunda convocatoria, Jorge Ferrer-Vidal Turull (con Sobre la piel del mundo, prologado por Padrós), quien en 1954 había despertado la atención de la crítica con la novela El trapecio de Dios, aparecida en la lujosa colección de Josep Janés (1913-1959) La Botella Errante. Y a este le seguirían, antes de la aparición de Los jefes, las primeras obras de una serie de autores que pueden más o menos inscribirse en un tipo de realismo de crítica social: La noticia (1958), de Manuel San Martín (1930-1963), quien dos años después sería finalista del Premio Planeta con El borrador (1960); Los desterrados (1958), de Ramon Nieto (n. 1934), que previamente había publicado sólo La Tierra y que en años posteriores desarrollaría una amplia labor editorial (en Santillana, Altea, la Unesco, Salvat, Alhambra); Aljaba, de Esteve Padrós, La rebusca y otras desgracias (1958), con el que se estrenaba en las letras de molde Daniel Sueiro (1931-1986), que al año siguiente obtendría el Premio Nacional de Literatura con Los conspiradores (reeditado en Menoscuarto en 2006) y Muertos y vivos, de Julián Gállego (1919-2006), que años más tarde ganaría el Leopoldo Alas con Apócrifos españoles (1967).

kurtzcamino

En un díptico sobre las primeras publicaciones de la colección, Eduardo Tijeras hacía un primer intento de señalar la tendencia predominante en esta colección de la Editorial Rocas, en unos términos muy de época y hoy bastante sorprendetes, y en la que se inscribiría Los jefes:

En lo referente a modismos dialogales, [Ferrer-Vidal] sigue una tendencia parecida a la de Olmo (recurrimos a la comparación para fijar y unificar de algún modo tales conceptos), es decir, que ambos gustan de poner en boca de sus personajes expresiones populares, barriobajeras, libertarias [sic] y magnetofónicas, lo que se ha venido en denominar realismo objetivo o cinematográfico, y que son, desde luego, acusadoras de un estado social vigente.

Y al libro inaugural del joven escritor peruano le seguirían otros libros no muy alejados de esta línea firmados por nombres tan notables como los de Víctor Mora (1931-2016), Ana María Matute (1925-2014), Carmen Kurtz (1911-1999) o Ignacio Aldecoa (1925-1969) entre los más destacados.

arrepentidamatuteEste es el contexto en el que se publica, pues, el primer libro de cuentos de Vargas Llosa, originalmente con prólogo de Joan Planas Cerdà, un dibujo de Clara Guillot y tan sólo cinco cuentos («Los jefes», «El desafío», «El hermano menor», «Día domingo» y «El abuelo»). El que habitualmente suele incorporarse en ediciones recientes, «Un visitante», se publicó por primera vez en la edición de la limeña Populibros Peruanos en 1963 en sustitución de «El abuelo», y fue en la edición también limeña de José Godard Editor cuando por primera vez el libro tomó la forma con que hoy es conocido, acogiendo los seis cuentos mencionados.

De escritura posterior a «Los jefes», «El abuelo» es sin embargo el primer cuento que había publicado Vargas Llosa, en las páginas de El Dominical del periódico de Lima El Comercio, el 9 de diciembre de 1956, y acerca del que posteriormente diría:

«El abuelo» desentona en este conjunto de historias adolescentes y machistas. También él es residuo de lecturas —dos bellos libros perversos de Paul Bowles: A delicate Prey y The Sheltering Sky— y de un verano limeño de gestos decadentes; íbamos al cementerio de medianoche, adorábamos a Poe y, en espera de hacer algún día satanismo, nos consolábamos con el espiritismo.

losjefesEn febrero del año siguiente «Los jefes», que el autor describió luego como «un eco desafinado de L’espoir de Malraux, que iba leyendo mientras lo escribía», apareció en forma de separata de la longeva revista Mercurio Peruano (fundada en 1918) que en aquellos años dirigía el reputado historiador peruano César Pacheco Vélez (1929-1989). Tampoco era inédito «El desafío», cuya historia editorial es un poco más compleja y se inicia cuando en 1957 lo presenta a un galardón convocado por la Revue Française y se lleva el premio (consistente en un viaje a París). Su primera aparición pública la hizo este cuento en el número 98 la mencionada revista en la traducción al francés llevada a cabo por el profesor André Coyné (1927-2015) y revisada por Georgette Marie Philippart Travers (1908-1984), más conocida como Georgette Vallejo por el hecho de ser la viuda de César Vallejo y haber logrado mantener a salvo y conservar a través de dos guerras (la civil española y la segunda mundial) el legado del poeta César Vallejo (1892-1938).

A estos tres cuentos añadió Vargas Llosa otros dos escritos más o menos por esos mismos años en el envío que desde Madrid preparó como candidatura al Premio Leopoldo Alas en su edición de 1958, en la que se alzó como vencedor y, según confesaba a Xavi Ayén, eso le decidió a tomar la seria determinación de hacerse escritor, y en términos muy similares se expresó en una entrevista con Leandro Pérez Miguel: «Ahí empezó mi vida de escritor, al menos oficialmente. Creo que [Los jefes] es un libro donde se ve una personalidad en proceso de formarse. Los jefes es un pequeño microcosmos de lo que vendrían a ser el resto de mis libros».

Es posible que la primera mención que aparece en prensa de la inminente aparición de este volumen sea la que se publicó en el número 115 de Cuadernos Hispanoamericanos (julio de 1959) del ya mencionado Eduardo Tijeras, que contiene una hoy chocante errata precisamente en el nombre del por entonces autor novel: «El último premio Leopoldo Alas, concedido recientemente al libro Los jefes, de Mariano Vargas, aún no ha visto la luz pública».

badosa

Enrique Badosa.

Sin embargo, los cuentos de ese joven peruano de veintipocos años reunidos en Los jefes están más cerca del estilo que caracterizaba las propuestas de la Editorial Rocas que de los derroteros que iría tomando la narrativa de Vargas Llosa en los años inmediatamente posteriores. Si bien es poco cuestionable el parentesco entre los ambientes, las atmósferas, los personajes e incluso los temas presentes en estos cuentos y los que aparecen en obras como La ciudad y los perros (1963) o Los cachorros (1967), uno de los más perspicaces miembros del jurado que le galardonó, Enrique Badosa, identificó retrospectivamente el que tal vez sea principal rasgo que marca un hiato entre este libro inicial y los posteriores, durante una conversación del autor con varios editores barceloneses en 1967:

En su primera obra, Los jefes […] emplea usted un estilo que se podría denominar convencional; esto es, un estilo en el que, desde fuera de la obra, el narrador describe personajes, hechos y diálogos. En Los cachorros, por el contrario, usted se sitúa, por así decirlo, en el seno mismo de lo relatado, más casi como sujeto paciente de su literatura que como sujeto agente. Por otra parte, en Los jefes la originalidad creadora era buscada, sobre todo, en la novedad del argumento, mientras que en Los cachorros esa originalidad se busca más en el cómo se dice lo que se dice.

Es muy conocido, porque se ha repetido muchas veces, que la sugerencia de presentar su segunda obra a Carlos Barral le llegó a Vargas Llosa en París a través del hispanista Claude Couffon (1926-2013), quien consideraba al por entonces director de Seix Barral el único capaz de conseguir que La ciudad y los perros pasara sin daños excesivos por la censura española, pero en cualquier caso es evidente que, debido a la línea editorial de Rocas, centrada en el cuento realista con un componente de crítica social, la evolución del escritor peruano no hubiera tardado en desentonar en el catálogo de quienes le descubrieron como narrador.

Aun así, el galardón y la publicación a Los jefes, añadida a la de obras primerizas de tantos otros autores que no tardarían en consagrarse mediante premios de mayor relumbrón, son muy indicativos del buen olfato y la intuición del grupo que gestionaba la Editorial Rocas, capitaneado por Enrique Badosa, quien poco después se convertiría en una de las piezas importantes de la editorial Plaza & Janés, sobre todo como director del departamento de Lengua Española y de las colecciones Selecciones de Poesía Española y Selecciones de Poesía Universal.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

El grueso de los autores del boom en Barcelona. Al fondo a la izquierda, al lado de Barral, puede verse a Vargas Llosa.

Fuentes:

Xavi Ayén, «Vargas Llosa: “Barcelona me hizo escritor”», La Vanguardia, 10 de octubre de 2010.

Enrique Badosa, Juan Ramón Masoliver, Joaquín Marco, Esther Tusquets, Carlos Barral y Jose María Castellet, «”Realismo” sin límites. Vargas Llosa, diálogo de amistad», Índice, núm. 224 (octubre de 1967, pp. 21-22. Recogido en Joaquín Marco y Jordi Gracia, eds., La llegada de los bárbaros. La recepción de la narrativa hispnoamericana en España, 1960-1981, Barcelona, Edhasa (El Puente), 2004, pp. 479-484.

Ernesto Mauri, «En recuerdo de Esteban Padrós de Palacios», Luke, núm. 97 (junio de 2008).

Leandro Pérez Miguel, «Mario Vargas Llosa: “Los jefes es un microcosmos del resto de mis libros”», El Mundo, 11 de agosto de 1999.

Eduardo Tijeras, «Noticia sobre el Premio Leopoldo Alas», Cuadernos Hispanoamericanos, núm. 115 (julio 1959), pp. 68-72.

Eduardo Tijeras, «Segunda noticia sobre la colección Leopoldo Alas», Cuadernos Hispanoamericanos, núm. 125 (mayo 1960), pp. 236-238.

Mario Vargas Llosa, «Acerca de mis primeros cuentos», en Lauro Zavala, ed., Teorías del cuento II: La escritura del cuento, México, Universidad Nacional Autónoma de México, Textos de Difusión Cultural. Serie El Estudio, 1995, pp. 207-212.

 

La editora catalano-mexicana Neus Espresate Xirau y su generación

Neus Espresate Xirau, nacida en Canfranc (Huesca) el 5 de enero de 1934 y fallecida en la Ciudad de México el 21 de febrero de 2017, perteneció a una generación de intelectuales nacidos en España, trasladados a América siendo aún niños y que tuvieron una formación bastante peculiar.

tomasespresate

Tomàs Espresate.

En los años treinta, su padre, Tomàs Espresate Pons (1904-1994) había sido un destacado líder socialista en la provincia de Huesca y al estallar la guerra civil española se trasladó a Barcelona, donde quedaron sus hijos cuando, al caer Barcelona en manos franquistas, Tomàs cruzó la frontera y se trasladó inicialmente a París, donde trabajó en el SERE (Servicio de Evacuación de Refugiados Españoles). En el verano de 1940, con las tropas franquistas a un paso de la capital francesa, Tomàs Espresate se trasladó a Marsella, desde donde intentó salir hacia México con su esposa, cosa que no logró hasta la primavera de 1942, y desembarcó del Nyassa el 22 de mayo de ese año. Antes de que pudieran reunirse con él sus hijos, Jordi, Francesc (Quico) y Neus, que llegó con doce años, había creado una empresa de comercio textil y, en colaboración con el zaragozano Enrique Naval (1901-1958) –quien en Argentina había puesto en pie con Epifanio Madrid la editorial Bajel, que entre otras cosas publicó De un momento a otro, de Alberti–, crearon la empresa Crédito Editorial y posteriormente la Librería Madero, a la que años más tarde añadirían una pequeña imprenta en la que reside el origen de las Ediciones Era.

Tras unos años de escolarización en centros educativos franquistas, Neus Espresate forma su personalidad en México inicialmente en el ámbito de los centros creados por exiliado españoles desde 1939 con el propósito de que los hijos de los republicanos españoles pudieran seguir su educación hasta el momento de regresar a su país de origen, cosa que se suponía que podrían hacer en cuanto las fuerzas aliadas acabaran con las dictaduras fascistas en Europa. En consecuencia, la formación de estos niños, aun siendo hispanomexicana, daba mucha importancia a la geografía, la historia, la literatura y en general la cultura españolas, lo que posteriormente los singularizó entre sus compañeros universitarios.

En la Imprenta Madero confluyen en los años cincuenta los hermanos Jordi y Francesc Espresate (1932-2013) con Vicente Rojo (Barcelona, 1932) y José Hernández Azorín. Se trata de un núcleo de jóvenes nacidos en España, próximos al socialismo y comprometidos con el antifranquismo, que en 1960 pondrían en pie las Ediciones Era, en compañía además de otros hijos de exiliados republicanos como Nuria Galipienzo, Pili Alonso, Adolfo (Fito) Sánchez Rebolledo o el abogado Carlos Fernández del Real.

Jomi García Ascot

Jomi García Ascot

Por aquel entonces habían podido seguir muy de cerca las primeras iniciativas editoriales de sus compañeros generacionales, como las revistas promovidas por universitarios que habían abandonado España de niños tales como Clavileño (1948), de Luis Rius, Arturo Souto Alabarce, Inocencio Burgos, etc.; Presencia (1948-1950), editada por Enrique Echeverría, Jomí García Ascot y Roberto Riuz; Hoja (1948), en cuyas Ediciones de la revista aparecieron los primeros libros de Tomás Segovia (1927-2011) y Enrique de Rivas (n. 1931) o Segrel (1951), que publicó también el libro Canciones de vela (1951), de Luis Rius (1930-1984). No es extraño, pues, que ya en los primeros años de su andadura Ediciones Era contribuyera a dar a conocer la poesía de Jomi García Ascot (Un otoño en el aire,1964), Luis Rius (Canciones de amor y sombra,1965) y Tomás Segovia (Historias y poemas, 1968) y un poco más adelante tuviera también el acierto de publicar la importante Historia documental del cine mexicano (1978), de Emilio García Riera.

Eran los años también en que sus compañeros hispanomexicanos estaban empezando a forjarse un nombre en el mundo editorial, con Joaquín Díez Canedo (1917-1999) a la cabeza con su independiente Editorial Joaquín Mortiz, creada en 1962, pero también, sobre todo en la órbita del FCE, Tomás Segovia (1927-2011) como excelente traductor literario, Juan Almela Castell (1934-2014), conocido como poeta Gerardo Deniz, que hizo labores de edición y corrección, o José de la Colina (n.1934), que hizo también trabajos de corrección y traducciones para González Porto, el Fondo y Era, Francisco González Aramburu, también corrector y traductor… Sin embargo, más importante aún como aglutinadora de estos intelectuales hispanomexicanos fue la iniciativa del Movimiento Español 1959 (ME/59), que había reunido poco antes de la fundación de la editorial a Vicente Rojo, Luis Rius, García Ascot, Xavier de Oteyza, Jordi Espresate, José de la Colina, Manuel Duran, Martí Soler, José Pascual Buxó y Elena Aub entre otros muchos, y entre cuyos propósitos estuvo el de publicar libros con la intención de distribuirlos en España.

Max Aub, J. Díez-Canedo, Alí Chumacero, Agustín Yáñez y Ricardo Martínez.

Max Aub, J. Díez-Canedo, Alí Chumacero, Agustín Yáñez y Ricardo Martínez.

Ediciones Era nace como una editorial de izquierdas firmemente arraigada a México, a su realidad social y política, con la que se compromete desde el primer momento, y lo hace abriéndose a la obra de los nuevos creadores en lengua española en un sentido muy amplio y a aquellos ensayos del ámbito de las ciencias humanas que, más por reticencias ideológicas que por cuestiones de rigor o de calidad, muy difícilmente podían encontrar su espacio en las grandes editoriales del momento. Aun así, los temas españoles y en particular los derivados de la guerra civil tienen una presencia mayor que en cualquier otra editorial de su tiempo (con la salvedad de Ruedo Ibérico).

neusespresate

Neus Espresate.

Ya las circunstancias que rodearon la aparición del primer libro de Ediciones Era, con la que estrenaba la colección Ancho Mundo, es significativo e ilustrativo tanto del momento histórico como del perfil ideológico de la editorial y de su firme apuesta por un tipo de literatura estrechamente vinculada con el reportaje periodístico: La batalla de Cuba. Fisonomía de Cuba, un volumen en cuya primera parte lo constituye un amplio ensayo a modo de reportaje del historiador Fernando Benítez (1912-2000) y la segunda es una breve semblanza de la Cuba prerrevolucionaria escrita por el catedrático Enrique González Pedrero (n. 1930), quien ya había abordado el mismo tema en La revolución cubana (UNAM, 1959) y quien entre 1955 y 1957 había adquirido experiencia como secretario de redacción de la revista del Fondo Económico de Cultura El Trimestre Económico, fundada en 1934 por Daniel Cosío Villegas y Eduardo Villaseñor y por aquel entonces dirigida por Víctor L. Urquidi y Javier Márquez. En cuanto al aspecto de La batalla de Cuba, Vicente Rojo se ocupó tanto del diseño como de la reproducción de las numerosas imágenes fotográficas a color como del mapa a color que incluye y de diversas tablas.

Max Aub, Juan Goytisolo y Vicente Rojo.

Max Aub, Juan Goytisolo y Vicente Rojo.

En una intensa entrevista de Guillermo Sánchez Cervantes, publicada en Gatopardo, Neus Espresate ponía de manifiesto la importancia que tuvieron las colaboraciones en los pasos iniciales de Era, y en particular la ayuda recibida de Benítez y del editor de origen argentino Arnaldo Orfila. El vínculo con Benítez procedía del hecho de que, a la muerte del diseñador gráfico también exiliado Miguel Prieto (1907-1956), Rojo fue al hombre a quien recurrió Benítez para que le sustituyera como dirección gráfica de los prestigiosos suplementos México en la Cultura y luego La Cultura en México, que tenían como colaboradores más o menos asiduos a muchos otros hispanomexicanos (Tomás Segovia, Gerardo Deniz, García Riera, Núria Parés, Manuel Duran, Ramon Xirau, Francisca Perujo, Agustí Bartra…), así como a autores que no tardarían en estrenarse en Era: Mosiváis, Monterroso, José Revueltas, Poniatowska, José Emilio Pacheco…

La mención de algunos títulos es indicativa de las intenciones y los caminos que pretendía transitar el equipo fundador de Ediciones Era. También de 1960 es por ejemplo la traducción de Francisco Álvarez Iraola de Sudáfrica: la tragedia del apartheid, de Norman Phillips, asimismo con ilustraciones fotográficas, y de esos primeros años 3b4ae-sierradeteruel1945algunos títulos permiten aquilatar el equilibrio que en ERA va construyéndose entre el compromiso político –en el que marca un hito la creación de la revista Cuadernos Políticos (1974-1990), donde se darán a conocer los grandes politólogos y ensayistas latinoamericanos de izquierda– y la nueva literatura de alta exigencia estética: el libro que recopilaba las entrevistas llevadas a cabo por Elena Poniatowska que ningún periódico se atrevía a publicar, Palabras cruzadas (1961);  México. Pintura Activa (1961), de Luis Cardozo y Aragón, en la espléndida colección Imágenes; España heroica. Diez bocetos de la guerra española (1961), del general republicano Vicente Rojo, padre del diseñador de la casa; Franco, Hitler y los Estados Unidos (1962), de E. N. Dzelepy; Aura (1962), de Carlos Fuentes; Breve historia de Coyoacán (1962), de Salvador Novo; El único camino (1962), de Dolores Ibárruri; El cine mexicano (1963), del Emilio García Riera (Ibiza, 1931-México D.F., 2002); Cuentos del Sur y Diario de México (1963), del chileno Manuel Rojas, El coronel no tiene quien le escriba (1963), de García Márquez…, así como un curioso libro de Frédéric Rossif Madeleine Chapsal titulado Morir en Madrid (1963), montado a partir de fotogramas de la película documental dirigida por Rossif para la que se sirvió de numerosas películas de época y que en 1965 fue nominada al Oscar al mejor documental (el 1967 obtuvo el BAFTA en la misma categoría). Ahí está el precedente de otra obra importante basada en guiones cinematográficos vinculados a la guerra civil, Sierra de Teruel (1968), de André Malraux, que Era publicó en traducción y con prólogo de Max Aub en una espléndida colección dedicada al cine.

amorysombraTambién es orientativo ver a qué editoriales compraron en sus principios más derechos los jóvenes creadores de ERA para editar las correspondientes traducciones: Gallimard, Edizioni Avanti, Pantheon Books, Julliard, Libraire François Maspero, Monthly Review, New Left Books… Que en Era se publicara la obra de algunos exiliados republicanos, como por ejemplo Menesteos, marinero de abril (1965), de María Teresa León, la Poesía española contemporánea, de Max Aub (1969) o Las ideas estéticas de Marx (1965) y Estética y marxismo (1970), de Adolfo Sánchez Vázquez, encaja perfectamente en el propósito expresado por la propia directora de la editorial, Neus Espresate –a quien se ha caracterizado como «la heredera de esa generación de grandes exiliados»– de dar a conocer desde México lo que no se podía publicar en España, y particularmente lo que hacía referencia a la guerra civil, y procurar luego introducirlo en la Península.

cardozayaragonAun así, como ha escrito Carlos Monsiváis, uno de los autores más arraigados en ERA, lo que singulariza a Era es la concepción latinoamericana de su postura ante la realidad:

En los años sesenta Ediciones Era comienza y el proyecto es y parece distinto porque, además de todo, el momento de América Latina es eléctrico, y Era surge como proyecto latinoamericano. Se cree en el cambio (que la mayoría adjetiva: cambio revolucionario), se observa con detalle lo que ocurre en Cuba… se vive con pasión las teorías de la dependencia, y por vez primera desde los treintas, la izquierda cultural está a la vanguardia, una izquierda desestalinizada, crítica, alejada del lenguaje torrencialmente histíorico de Vicente Lombardo Toledano […] Era publica entonces lo que las editoriales oficiales y la mayoría de las privadas no admiten, temas como el castrismo, la presencia de las transnacionales, el nuevo colonialismo….

Neus Espresate, quien tenía claro que no es fácil describir su trayectoria, porque «nos hemos cuidado de no definir: la mejor definición es conocer nuestros libros», desde el primer momento «La propuesta era entre publicar los libros que queríamos y los necesarios. Afortunadamente, esas dos intenciones se han ido conjugando hasta el momento [1994]».

Aun así, según la evaluación que se hizo en la Universidad Autónoma de México al decidir nombrarla doctora honoris causa:

La política editorial de ERA durante la gestión de su directora fue documentar y difundir los acontecimientos sociales más relevantes de la historia contemporánea de México y América Latina, al abrir un espacio al pensamiento crítico para expresarse, como lo demuestran los testimonios de sus autores y colaboradores más cercanos.

63c95-logo-erahorizontal

Fuentes:

AA.VV., “Entrevista con Neus Espresate y Vicente Rojo”, en Ediciones Era. 35 años, Guadalajara, Universidad de Guadalajara, 1995, pp. 61-83.

Elena Aub, Historia del ME/59. Una última ilusión, México, Consejo Nacional para la Cultura y las Artes-Instituto Nacional de Antropología e Historia (Palabras del Exilio 5), 1992.

exilio2agenManuel Aznar Soler y José Ramón López García, El exilio republicano de 1939 y la segunda generación, Sevilla, Gexel-Remacimiento (Biblioteca del Exilio. Anejos XV), 2011.

Colegio Académico de la UAM, «Acta de la Sesión 329», 2 de diciembre de 2010.

Teresa Férriz Roure, «Fernando Benítez, la prensa cultural mexicana y el exilio repubilcano», Arrabal, núm. 1, pp. 235-241.

Antonio Lago Carballo y Nicanor Gómez Villegas, Un viaje de ida y vuelta. La edición española e iberoamericana (1936-1975), Madrid, Siruela (El Ojo del Tiempo 9), 2006.

Elena Poniatowska, «Los españoles de antes», La Jornada, 28 de junio de 2015.

José Carlos Reyes Pérez, «El sueño mayor de hacer libros»: Era. Cultura escrita en español y la difusión de las ciencias sociales a través de una editorial, tesis presentada en el Centro de Investigación y Docencia Económicas, agosto de 2016.

Javier Rico Moreno, «El exilio español en México. Reencuentro y proeza en tinta y papel», Texturas, núm. 24 (septiembre 2014), pp. 91-108.

Guillermo Sánchez Cervantes, «Neus Espresate y los inicios de Ediciones Era», Gatopardo, 2011.

El trazo del impresor y editor Gabriel García Maroto

GabrielGarcíaMaroto

Gabriel García Maroto.

Es posible que fuese la cantidad, amplitud y diversidad de intereses lo que hiciera que Gabriel García Maroto (1889-1969) no desarrollara una carrera más importante como editor, pero le bastaron unos meses de dedicación a tales menesteres para ganarse un puesto en la historia de la literatura española, encuadrado además en lo que comúnmente conocemos como la generación del 27, con la que se relacionó profusamente en los años veinte.

El tesón que puso ya desde muy joven en La Solana (Ciudad Real) en intentar convertirse en pintor da fe de la firmeza de esta vocación y de su apasionada dedicación al arte pictórico. Sólo al tercer intento, después de suspender en junio de 1908 y junio de 1909, consiguió ingresar en la madrileña Escuela Especial de San Fernando (nombre por entonces de la Academia de Bellas Artes San Fernando), y tanto su participación en exposiciones colectivas como sus primeras incursiones en el periodismo (La Tarde, El País, Vida Manchega) hacían ya pensar que ese sería su camino, acaso con algunos paréntesis para la poesía de raíz modernista. Sin embargo, al regreso de un viaje por Italia, Francia, Bélgica y Holanda, consecuencia de haber obtenido una bolsa de viaje como premio en la Exposición Nacional de Bellas Artes, en 1921 estableció una imprenta en la calle Alcántara (números 9-11) que enseguida despertó la atención del poeta y editor Juan Ramón Jiménez (1881-1958).

JuanRamonJimenez

Juan Ramón Jiménez.

Los tres primeros números de la juanramoniana revista Índice, en la que aparecieron los grandes nombres del momento, de Díez-Canedo a Bergamín, de Ortega y Gasset a Salinas y de Moreno Villa a Federico García Lorca, debiera haber sido un espaldarazo para esta incipiente Imprenta Maroto, profundamente marcada por los orígenes y el carácter autodidacta de su fundador, aunque también es de suponer que su personalidad y gustos chocaran, ya con motivo del tercer número, con los del poeta de Moguer. En Imprenta Moderna Andrés Trapiello hace de García Maroto una caracterización significativa en este sentido:

La mayor parte de los libros que salieron de sus manos seguían teniendo un apresto pueblerino (mal papel, diseño tradicional, tipos convencionales), sus viñetas y sus capitulares, y personalísimas caligrafías, le dieron un aire verbenero muy de esos años. Todo lo que hizo acaba teniendo un aire proletario de almanaque popular, y supo buscar para la imprenta un término medio que combinara los tiovivos y los sombríos humeros de las fábricas.

En cambio, a tenor de este carácter, a nadie extraña que estableciera buena amistad con Federico García Lorca y que tuviera una responsabilidad importante no sólo en cómo se publicó su primer libro, Libro de poemas (1921), sino incluso en el hecho mismo de que el poeta granadino se decidiera a darlo a imprenta. Hasta qué punto es responsabilidad de García Maroto la selección, ordenación y disposición de los poemas de este libro lorquiano sigue siendo objeto de controversia y parece muy difícil de esclarecer, del mismo modo que siguen abiertas las dudas acerca de la autoría de las «Palabras de justificación» con que se abre este volumen con que Lorca se dio a conocer en junio de 1921.

libropoemaslorca

Además de esa excelente revista y este libro liminar, que parecen situar la imprenta de García Maroto en un momento inicial de un movimiento literario de enorme repercusión, también en 1921 salen de esas prensas el librito (12 cm) del poeta peruano Luis de la Jara Espigas, que en cierta medida es indicativo del momento cultural, por dejar atrás el rubendarianismo para adentrarse en el ultraísmo. Del mismo año es otro volumen que pone de manifiesto la proximidad de García Maroto a la literatura y los creadores americanos, el libro de Oscar Vladislaw de Lubicz-Milosz Poemas, en traducción del escritor chileno Augusto d´Halmar (1882-1950), que Julio Francisco Neira Jiménez describe como «un volumen en octavo, de tamaño por completo inadecuado, pues la mucha longitud de los versos hace que deban volver a la otra línea casi todos, lo que afea la página y hace la lectura muy incómoda».

Antes de acabar 1921 García Maroto organizó una Primera Exposición de Pinturas, entre cuyos participantes se encontraban también su amigo Lorca y el dibujante y pintor de origen uruguayo Rafael Barradas (1890-1929), en lo que sin duda es una primera tentativa de la que años más tarde, en colaboración con Guillermo de Torre y Manuel Abril, sería la ambiciosa Primera Exposición de Artistas Ibéricos (1925), que tanta incidencia tuvo en el reconocimiento de artistas como José Moreno Villa (1887-1955), Benjamín Palencia (1894-1980) o Salvador Dalí. Sin embargo, a finales de 1921 reemprendía su sino viajero, en esa ocasión en compañía del diputado socialista Fernando de los Ríos (1879-1949) y del periodista Julio Álvarez del Vayo (1891-1975) a Berlín, para, entre otras cosas, ponerse al día en cuestiones de tipografía, mientras la imprenta Maroto quedaba a cargo de su hermano Santiago.

biblos

Su fama como pintor e ilustrador (entre otras, para las famosas Revista de Occicente y La Gaceta Literaria) iba en aumento, pero eso no le impidió ocuparse del librito no venal de José María de Hinojosa (1904-1936) Poema del campo, que apareció ya en 1925 con una imagen de cubierta obra de Salvador Dalí (1904-1989). Aun así, la siguiente empresa en la que se embarcó, más ambiciosa, no se hizo realidad hasta 1927, probablemente debido a sus actividades en el ámbito del arte.

Su personalidad como tipógrafo –escribe Trapiello– viene condicionada por su personalidad de pintor, ya que las tipografías que usará son de su invención y, rasgo característico suyo, dibujadas. No se trata de tipos móviles o cubiertas compuestas, sino… dibujadas por él. Lo hizo en muchos de estos libros personales y lo hizo en la editorial que fundó, Biblos, en la que se publicaron algunos libros de clara tendencia revolucionaria y que fue sin duda su más característica y conseguida empresa.

La salida a la palestra de esta editorial casi coincide con el viaje que García Maroto emprendió en enero de 1928 a Estados Unidos, Cuba y México, donde se estableció hasta 1934 y donde, como señala Marina Garone, tuvo una importante participación en los movimientos de vanguardia y en la fundación de la revista Los Contemporáneos, cuya cabecera se le atribuyeEdiciones Biblos nace de la confluencia de García Maroto con el traductor comunista Ángel Pumarega García, que había sido corrector en Revista de Occidente, y el también traductor Carlos Pellicena Camacho, que actuó como administrador, y mientras que Pumarega se ocupaba del grueso de las traducciones, García Maroto era el principal ilustrador y se ocupó de la dirección de las colecciones Imagen (dedicada a la novela y donde publicó Los de abajo, de Mariano Azuela, y La caballería roja, de Isaac Babel, entre otras), Clásicos Modernos (que se estrena con Barbas de estopa, de Dostoievski), y las colecciones de ensayo Idea y Mosaico.

losdeabajo

En esta misma editorial publica García Maroto el que está considerado como uno de sus mejores libros, 1930. La Nueva España. Resumen de la vida artística española desde el año 1927 hasta hoy (1927), que incorpora casi un centenar de grabados, así como Andalucía vista por el pintor Maroro. 105 dibujos y 25 glosas y 65 dibujos, grabados y pinturas, con una autocrítica y diferentes opiniones acerca de este autor, también aparecidos ambos en 1927. Buena parte de la labor emprendida por Ediciones Biblios la heredaría luego las Ediciones Jasón, enmarcadas en el conglomerado de editoriales Central de Ediciones y Publicaciones (auspiciada por el Komintern).

Simultáneamente, aún en 1927, García Maroto pone en marcha por su cuenta y riesgo una editorial Biblioteca de Acción, en la que publica, impresa lógicamente en sus talleres, Un pueblo en Mallorca, España mágica, Jesús entre nosotros y un Almanaque de las artes y las letras para 1928 o, estando ya él en América, Veinte dibujos mexicanos, precedidos de un prólogo del diplomático y escritor mexicano Jaime Torres Bodet (1902-1974).

García Maroto ya no regresaría a España hasta la primavera de 1934, y ese mismo año fundó Imagen. La Casa Escuela del Sordomudo, para la que de inmediato creó también una editorial (Biblioteca Imagen). Al mismo tiempo fue implicándose en la política cultural republicana, participando en la remodelación de la Escuela de Bellas Artes y trabajó en los proyectos de reforma de las Exposiciones Nacionales y de la Dirección General de Bellas Artes, actividades que se intensificaron a raíz del inicio de la guerra civil, en que se implica en la Alianza de Artistas Antifascistas y sirve como subcomisario general de Propaganda (a las órdenes directas de Álvarez del Vayo).

Al concluir la guerra se instaló definitivamente en México, donde desarrolló el grueso de su enorme actividad como pedagogo autodidacta, especializado en la enseñanza a sordomudos, alternando esta actividad con colaboraciones como dibujante y ocasionales exposiciones de pintura.

DaliMVillaBuñueLorca

De izquierda a derecha: Dalí, Moreno Villa, Buñuel, Lorca y José Antonio Rubio en los años veinte.

Fuentes:

Gonzalo Anes y Álvarez de Castrillón, dir., Diccionario biográfico español, vol. XXII, Madrid, Academia de la Historia, 2011.

Jaime Brihuega, «Gabriel García Maroto y La Nueva España 1930 que los españoles leyeron en 1927», Cuadernos de Estudios Manchegos, núm. 19 (1989), p. 263-276.

Gustavo Bueno Sánchez, «Ediciones Biblos, 1927-1928», filosofía.org.

Miguel Cabañas Bravo, «De La Mancha a México: la singular andanza de los artistas republicanos Gabriel García Maroto y Miguel Prieto», Migraciones y Exilios, núm (2005), pp. 43-64.

maroto-contemporaneosMarina Garone, «El trazo de los pinceles. El dibujo de la letra en el diseño gráfico mexicano de la primera mitad del siglo XX», Monográfico.org. Revista Temática de Diseño, junio de 2012.

Julio Neira, De musas, aeroplanos y trincheras (poesía española contemporánea), Madrid, Universidad Nacional de Educación a Distancia, 2015.

Aurora M. Ocampo, Diccionario de Escritores Mexicanos. Siglo XX. Desde las generaciones del Ateneo y Novelistas de la Revolución hasta nuestros días, vol. III, México D.F., Centro de Estudios Literarios de la Universidad Nacional Autónoma de México, 1993.

Andrés Trapiello, Imprenta Moderna.. Tipografía y literatura en España, 1874-2005, València, Campgràfic, 2006.

James Valender, «García Maroto y el Libro de poemas de García Lorca», Nueva Revista de Filología Hispánica, vol. 4, núm 1 (1996), pp. 156-165.

El acto de editar como acto de escritura/lectura. Entrevista a Gustavo Guerrero

Gustavo Guerrero (Caracas, 1957), profesor universitario, crítico literario y ensayista, escritor y consejero literario para el ámbito de la lengua española en Gallimard, desde hace ya varios años ha asistido desde una posición privilegiada a los procesos de internacionalización de la literatura española y latinoamericana, en los que París ha desempeñado un papel fundamental.

expo-sarduyguerrerowal176

Gustavo Guerrero y el editor François Wahl (1925-2014).

Llegas a París, habiéndote graduado en Derecho en la Universidad Andrés Bello, ¿qué te lleva a París?

En realidad, el viaje a París supuso una ruptura. Durante mis últimos años en Caracas vivía una doble vida: de día era un joven abogado especializado en derecho financiero (trabajaba en la colocación de bonos de la deuda pública en los mercados extranjeros) y de noche escribía reseñas y notas bibliográficas para el suplemento literario del periódico El Universal (por entonces uno de los más importantes de Venezuela) y también para otras publicaciones nacionales y extranjeras (entre ellas, la famosa Vuelta de Octavio Paz). Llegó un momento en que se hizo imposible seguir sirviendo a estas dos coronas.

genette

Gérard Genette (París, 1930).

La Fundación para la Cultura y las Artes de Caracas me ofreció una salida al otorgarme una beca de estudios en teoría y crítica literaria sobre la base de un dosier formado por mis artículos. Así salí de Venezuela y del mundo del derecho; así llegué a París y al departamento de teoría literaria de la Escuela de Altos Estudios en Ciencias Sociales. Pero el derecho y las finanzas no desaparecieron del todo. Han sido, por el contrario, dos herramientas esenciales para ejercer cabalmente el oficio de editor.

Cuando entras en la Escuela de Altos Estudios en Ciencias Sociales, Gerard Genette (n. 1930), que dirigió tanto tu licenciatura como tu doctorado, era ya una estrella de los estudios literarios, pero en 1982, justo cuando tú te diplomas, publica un ensayo tan influyente como el Palimpsestos. ¿Qué puedes contar del Genette profesor y de su influencia sobre tu modo de afrontar la literatura? Porque creo que proponía, sobre todo en Figuras III, un método de análisis de textos literarios muy útil y productivo.

Palimpsestos fue primero un seminario de dos o tres años en la Escuela, y luego una lectura capital. ¿Qué decía Genette en ese libro? Afirmaba que el sentido de una obra literaria no dependía de la sola estructura de su texto (algo que en aquel entonces aún parecía bastante herético) sino que variaba en función del entorno de ese texto y, en particular, de la manera como el objeto libro, a través de sus cubiertas, ilustraciones, cuartas de forro, solapas, etc., trataba de inducir o incluso de imponer una cierta interpretación. Para mí fue el descubrimiento de que el acto editorial podía ser un acto de escritura/lectura que implicaba la imposición de un sentido y secretaba (o trataba de secretar) un horizonte de recepción determinado. Editar era algo más que hacer libros; era conferir un sentido, formular una propuesta de lectura.

¿Cuáles eran tus experiencias editoriales cuando llegas a Gallimard?

logoduseuil

Logo de Éditions du Seuil, obra de Robert Lapoujade, que reproduce su sede entre 1945 y 2010: rue Jacob, 27.

Es una historia un poco larga. Antes de entrar a Gallimard, estuve trabajando durante tres años en Editions du Seuil. Allí me inicié en el oficio, junto a Severo Sarduy y a François Wahl. Todo partió de Genette, que también formaba parte del equipo de le Seuil (por entonces dirigía la colección Poétique). Recuerdo que el tema de mi tesina en la Escuela fue el concepto de neobarroco en la obra de Sarduy. Gracias al apoyo de Andrés Sánchez Robayna, ese trabajito universitario, algo retocado, se editó en Barcelona con el título rimbombante de La estrategia neobarroca (1988). Pero antes de que se publicara, Genette se lo envió al propio Sarduy y éste se lo dio a leer a François Wahl, que era como el gran mandarín de toda el área de humanidades y ciencias sociales en la editorial. Ambos me propusieron que leyera y redactara informes para las colecciones de literatura extranjera.

Fueron unos años inolvidables. Se trabajaba muy a gusto, dentro de un clima de efervescencia, camaradería e informalidad. Todavía soplaban los vientos libertarios del mayo francés por los corredores de la casita de la rue Jacob. Cada libro se leía y se discutía con rigor, con apasionamiento, como si todos participaran en una misma aventura literaria, cultural y política. Redactar un informe era como realizar un ejercicio de crítica en el que se daba por sentado que la responsabilidad de un editor no se limitaba a garantizar un nivel de ventas. Había también una responsabilidad intelectual de saber por qué se hacía lo que se hacía, cómo y para quién. En la rue Jacob aprendí así a redactar informes, cuartas de forro y solapas, comunicados de prensa y hasta documentos comerciales; pero sobre todo a Seuil le debo una idea de lo que significa editar.

croixdusud

Un ejemplo de La Croix du Sud de Caillois: Sécheresse, de Graciliano Ramos.

Tu entrada como director del ámbito de la lengua española en Gallimard se produce en 1996 para sustituir a Severo Sarduy (1937-1993). Por la fecha en que se produce esa llegada de Sarduy, probablemente por problemas de salud ya no tendría ocasión de desarrollar grandes proyectos, pero aun así crea la Nouvelle Croix du Sud (1991-1995), que venía a revitalizar la Croix du Sud (1952-1970) iniciada por Roger Callois (1913-1978) a su regreso de Argentina.

A fines de los ochenta, Sarduy estaba ya muy enfermo y le era muy difícil llevar adelante el proyecto. Su idea era sin embargo original: la Nueva Cruz del Sur debía ser como una meta-colección que releyera críticamente, a veinte años de intervalo, la colección de Caillois. Por un lado, Sarduy pretendía poner en tela de juicio el aspecto pedagógico del latinoamericanismo de Caillois (habría que recordar que la colección de Caillois publicaba a la vez ensayos culturales sobre América Latina y novelas que debían ilustrar las realidades del continente); por otro, Sarduy aspiraba a ampliar y a actualizar la percepción que se podía tener de la literatura latinoamericana en Francia en aquel momento, editando autores anteriores o posteriores al boom, como Macedonio Fernández y César Aira, como Leopoldo Marechal y Luis Rafael Sánchez.

En 1990, cuando Sarduy deja le Seuil por Gallimard, me pide que ocupe el lugar de lector principal en su nuevo equipo. Así llego a Gallimard. Mi papel fue, en un comienzo, el del lector que debía ir buscando a los nuevos autores, pero la enfermedad de Sarduy hizo que la gestión del proyecto fuera cada vez más difícil dentro del equipo y que la nueva colección no consiguiera afirmarse como una propuesta viable. Cuando en 1993 muere Sarduy, aún quedan algunos títulos por publicar y hay que ocuparse de ellos. Mi intención era editar esos títulos pendientes y luego marcharme a los Estados Unidos, a seguir una carrera universitaria allí. Ese fue el plan hasta que, en 1996, Antoine Gallimard me encargó la gestión editorial de toda el área iberoamericana en la colección Du Monde Entier.

nouvellecroixdusud

Un ejemplo de la Nouvelle Croix du Sud.

Con antecedentes tan ilustres en el cargo, como Valéry Larbaud, Héctor Bianciotti, Caillois o Sarduy, su legado en Gallimard debía de resultar de entrada un poco intimidatorio o imponía un nivel de exigencia bastante alto en cuanto a la literatura americana en español, ¿no? ¿Qué sesgo nuevo pretendías darle o cuál era tu intención respecto de las letras en lengua española en Gallimard?

Digamos que las cosas se fueron haciendo gradualmente, lo que les quitó peso y presión. Además, no eran ya los mismos tiempos ni los mismos públicos, ni tampoco la misma editorial. El fracaso de la Nueva Cruz del Sur me sirvió para entender que ya no se podía seguir defendiendo el principio de una colección latinoamericana al margen de las colecciones generales de literaturas extranjeras, como Du Monde Entier. Había que partir del fondo excepcional de autores iberoamericanos que teníamos (y tenemos) en esa colección y pensar una política destinada a preservarlo, renovarlo y ampliarlo. Preservarlo significaba entonces (y significa ahora) conservar dentro de la casa a los autores principales del catálogo: Borges, Cortázar, Onetti, Cabrera Infante, Paz, Fuentes, Vargas Llosa… Había que seguir publicando sus obras y garantizarles una presencia continua. Esa fue mi primera línea de trabajo.

Luego, estaba (y está) la segunda: la renovación del fondo a través de nuevas traducciones de algunos clásicos, como Rulfo, por ejemplo, o Josep Pla. Se trataba (se trata) de transformar en ventaja lo que es un problema para el editor de literatura extranjera: el envejecimiento acelerado de las traducciones.

En fin, la tercera línea de mi trabajo editorial fue (y es) la ampliación del fondo con la incorporación de dos tipos de autores: los ya altamente consagrados y canónicos, como Ricardo Piglia, Javier Marías o Sergio Pitol, y las figuras más recientes que son objeto de un cierto consenso crítico, como Yuri Herrera, Hernán Ronsino, Rodrigo Blanco Calderón y Samantha Schweblin, para citar solo a los más recientes.

cailloisocampo

Roger Caillois y Silvina Ocampo (1903-1993).

¿La reivindicación que a menudo se hace de España como puente entre la creación latinoamericana y los mercados europeos, que en relación a lo que conocemos como el boom quizá sea menos controvertido, hasta qué punto se corresponde, históricamente, con la realidad o es una exageración? ¿Cómo ha sido, históricamente, la relación entre los escritores en español y los lectores franceses?

La relación con el público francés es una vieja y buena relación, que se ha ido renovando a través de los años. Los autores de lengua española se traducen, se editan y son muy leídos dentro de un cierto sector del mercado que no se puede comparar con el de los autores anglos, claro, pero que está lejos de ser insignificante.

Sobre el papel de España como puente hacia los mercados europeos y la verdadera historia del boom, habría que matizar mucho e investigar más. Creo que se ha exagerado demasiado. El boom fue un fenómeno complejo y global en el que no hubo un solo actor sino varios. Y el protagonismo entre distintas plazas (Buenos Aires, México, La Habana, Barcelona, Paris) fue compartido. Hoy la situación también se hace cada vez más compleja y global, pues ya España no tiene el monopolio de la venta de los derechos de traducción de autores latinoamericanos, ni París es ya la única vitrina de la literatura mundial. Tanto el capital simbólico como el capital económico están más dispersos y la producción de valor, a nivel global, se ha fragmentado y atomizado. Es más difícil llegar a consensos críticos. Mira, si no, las interminables y dispares listas con que la prensa internacional nos castiga cada fin de año en París, Barcelona, Buenos Aires, Nueva York, México o Madrid.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

De izquierda a derecha: Castellet, García Márquez, Barral, Vargas Llosa, Félix de Azúa, Salvador Clotas, Cortázar y García Hortelano.

En el caso del boom, se asume a menudo que el espacio clave es Barcelona, y la agencia de Carmen Balcells en particular, para su internacionalización. Pero parece lógico pensar que sin traducciones podría haber quedado circunscrito al ámbito hispanohablante, y no fue el caso. ¿Qué pesa más en esa internacionalización, el hecho de que autores como Cortázar residan en París o la existencia de una larga tradición de relaciones entre Latinoamérica y Francia, quizá peor conocida? ¿Qué papel atribuyes en ello a Carmen Balcells?

Carmen Balcells transformó la venta de derechos de traducción en un negocio global. Su modelo fue el del marchant d’art que se implicaba en la vida y la obra de los artistas que representaba y los acompañaba en su aventura creativa. En este sentido, era una mujer notabilísima, que respetaba a sus autores, los conocía y conocía la literatura cuyos derechos de traducción negociaba. Ahora bien, sin el contexto internacional que trajo consigo la Revolución Cubana, sin la potencia y la experiencia del polo editorial de Buenos Aires (ahí estaban Sudamericana, Losada y tantas otras casas), sin las traducciones de la colección de Roger Caillois (que circulaban por toda Europa y llegaban a los Estados Unidos), sin Carlos Barral y sus premios, y en fin… sin tantos otros factores, como el genio de Cortázar, García Márquez y Vargas Llosa, sin todo esto no habría habido ningún boom. Así que no exageremos tanto, por mucho que queramos a Carmen y que nos guste Barcelona.

castelletvalverdepetitbarralvseix

De izquierda a derecha: Castellet, José M. Valverde, Joan Petit, Barral y Víctor Seix.

Lo que sí habría que subrayar es que Carmen, como la mayoría de las agentes españolas, era ante todo una gran lectora de sus autores, los conocía y conocía perfectamente sus obras, y cuando hablaba con un editor extranjero, sabía de qué le estaba hablando y sabían también con quién estaba hablando. Por encima de todo, era una mujer que conocía y amaba la literatura que se escribe en español en las dos orillas de la lengua. No siempre es el caso hoy, ya que la venta de derechos está a veces en manos de agentes que no leen el español ni saben nada de sus literaturas ni se interesan de veras en nuestros escritores; o solo saben hablar de su potencial comercial.

Posteriormente, enterrado ya Franco, París volvió a ser un núcleo de difusión importante en relación a la promoción de escritores españoles como Muñoz Molina (n. 1956), Julio Llamazares (n. 1955), Juan José Millás (n. 1952), Javier Marías (n. 1952), Luis Landero (n. 1948), etc., ¿no?

Rafael Conte (1935-2009).

Es cierto. Allá por los ochenta, cuando trabajaba en le Seuil, la promoción de la nueva ola española fue una de nuestras prioridades. Rafael Conte, amigo de la casa, hizo mucho por ellos. También José Miguel Ullán. Recuerdo el lanzamiento de las novelas de Eduardo Mendoza, o de los libros de la cuentista Cristina Fernández Cubas en París. Fue un gran momento de la narrativa española en Francia. Y creo que tuvo repercusiones en toda Europa, ciertamente.

 

En el caso de la literatura catalana, lo habitual es ampliar los lectores mediante la traducción primero al español, pero no fue ese el caso de Joan Sales y su Incerta glòria, cuya primera traducción fue la de Bernard Lesfargues al francés como Gloire incertaine en 1962 (la española, de Carlos Pujol, tuvo que esperar hasta 1969), pero que gracias a que apareció en una editorial como Gallimard luego fue contratada enseguida en otros países. Hay una vocación explícita, parece, de actuar desde Gallimard como puente entre culturas a través de las traducciones, ¿no es así?

Pascale Casanova habla en su libro La République Mondiale des Lettres (1998) del «efecto París», para referirse al impacto simbólico que supone, a un nivel internacional, la traducción al francés de un autor extranjero. No sé si todavía París tiene esa potestad, pero tradicionalmente las traducciones que publica Gallimard sí han tenido ese efecto canónico, un suplemento evaluativo reconocido por premios internacionales como el Nobel. La correspondencia de Caillois con muchos editores extranjeros constituye un registro de este modo de circulación de las traducciones francesas y de la atención que se les prestaba, que aún se les presta, a nivel internacional.

En la misma colección donde Gallimard sitúa, por ejemplo, las obras de Sándor Márai, Pasternak, Faulkner o Kundera, Du Monde Entier, puede encontrarse el Cahier gris de Josep Pla, Frémisante mémoire de Jesús Moncada, La place du Diamant, de Mercè Rodoreda. Y el tándem Ramón Chao-Serge Mestre ha traducido directamente del gallego varias obras de Manuel Rivas en diversas colecciones de Gallimard, que al parecer han sido en general bien acogidas. ¿Estas obras en otras lenguas peninsulares, llegan a Gallimard a través de traducciones previas al español, o hay una mirada puesta en el canon y las novedades de las literaturas gallega y catalana?

salesgallimard1962Sí se les ha dado una atención especial a las lenguas de la Península. Manuel Rivas se traduce en Gallimard directamente del gallego, como Moncada y Pla del catalán. Desde 1996 he tratado de tener siempre en mi equipo lectores de las diversas lenguas peninsulares y también de portugués, por supuesto. Rivas y Pla, entre otros, han sido acogidos con bastante éxito. De hecho, una de las aventuras editoriales más felices de estos últimos años fue la traducción integral del Quadern Gris, que solo se conocía en francés en una versión fragmentaria y muy reducida. Pla faltaba en el catálogo de Gallimard y traerlo fue como cumplir con una deuda pendiente para con un autor tan excepcional y tan francófilo. Sueño con traducir un día sus libros de vagabundeos gastronómicos.

Hay una impresión bastante generalizada de que en Francia hay un mayor reconocimiento hacia la labor del traductor, ¿responde eso a la realidad y, en tal caso, a qué lo atribuyes? Podría sorprender que en las traducciones francesas suele indicarse en los créditos si la traducción es del español de Chile, de Argentina, de Colombia o de México, ¿cómo encaja eso con la pretendida unidad de la lengua española?

Los traductores franceses han sostenido durante muchos años un largo combate para que se reconozcan sus derechos. Hoy se les tiende a considerar cada vez más como re-escritores y por ende como co-creadores de la obra que traducen. De ahí que su nombre aparezca sistemáticamente junto al del autor en las portadillas y los créditos. Me parece más que justo. Necesario.

También era justo y necesario hacerle un lugar a las variaciones del español y a los diversos españoles americanos. Siempre se indica en la portada, cuando se traduce del español, si procede de México, Cuba, Chile, etc. La lingüística reconoce la importancia de estas modalidades más allá o más acá de la unidad de la lengua, que es sobre todo un asunto político, no literario ni editorial ni científico.

josephinefelliermarcellinkristevabartheswahlsarduy

De izquierda a derecha: Josephine Fellier, Julia Kristeva, Roland Barthes, François Wahl y Severo Sarduy en los tiempos de Tel Quel.

En tanto que editor, no estrictamente como lector, ¿qué editor o editores te parece que por su modo de enfocar el trabajo, su talante o su obra te han servido de modelos o has aprendido de ellos?

Son muchos y es difícil no ser desagradecido e injusto. Ya te hablé de Sarduy y de Wahl. A ambos les debo una cierta fidelidad a las estéticas y al pensamiento de vanguardia. También los Gallimard han sido un modelo por la manera como reparten el peso entre el valor literario y las expectativas económicas: «encuentre usted buenos libros y el servicio comercial encontrará la forma de venderlos», me dijo Antoine Gallimard en nuestra primera entrevista.

Tendría que citar asimismo a Jorge Herralde por razones semejantes: en medio del huracán neoliberal, entre los noventa y dos mil, la literatura siguió siendo un valor en el catálogo de Anagrama y hoy se puede leer en él una propuesta de escritura/lectura arriesgada, influyente y sólida. No debería olvidar tampoco a los dos Manolos de Pre-Textos, Borrás y Ramírez, que desde Valencia nos siguen dando lo mejor de la poesía y el pensamiento contemporáneo contra viento y marea. Se me ocurren tantos otros nombres de colegas y amigos tan notables y tan diferentes, como Pilar Reyes y Jaume Vallcorba, como Joan Tarrida y Juan Casamayor; de todos ellos he aprendido algo en distintos momentos de estos años.

canagrama

De izquierda a derecha: Gustavo Guerrero, Lali Gubern y Jorge Herralde en la Feria de Frankfurt 2012.

Entre las generaciones más recientes, habría que citar a editores latinoamericanos como Leonora Djament de Eterna Cadencia, Eduardo Rabasa de Sexto Piso o Matías Rivas de la Diego Portales, que asocian la publicación de ensayos de humanidades, teoría y ciencias sociales, con literatura de la más alta exigencia. De hecho, algunas de las voces claves entre las nuevas generaciones de narradores y ensayistas han salido de esos catálogos. Acaso el factor común que los une es una apuesta por la innovación en pos de otro equilibrio entre las dos caras del oficio editorial – la comercial y la intelectual – después de unos años en que parecía que el afán de rentabilidad y los grandes conglomerados lo iban a devorar todo.

Algunos críticos literarios y profesores muy vinculados al sector editorial evitan ejercer la crítica literaria cuando esta puede entrar en conflicto con autores representados, editados o incluso con amigos, y de ahí que sólo reseñen obras de autores que, en ese plano y también en el académico, les quedan lejos. Tú, en cambio, tanto en la Nouvelle Revue Française como en Cuadernos Hispanoamericanos o Letras Libres siempre te has ocupado de las novedades de la literatura hispanoamericana, que ha sido también tu campo preferente tanto en la universidad como en el sector editorial. ¿Cómo se lleva esa cuádruple vertiente de escritor, editor, profesor y crítico literario? ¿No se producen ciertas tensiones en el momento de enjuiciar la obra de autores próximos en alguno de esos sentidos?

Tienes toda la razón. Claro que se produce una cierta tensión cuando se ocupan tantos lugares a la vez en el campo literario y hasta puede haber cierto conflicto de intereses. Esto me ha llevado a reducir drásticamente la publicación de reseñas y artículos de crítica en los últimos años, muy a mi pesar porque llegué a la edición a través de la crítica literaria y porque esa vocación primera sigue siendo con la que más me identifico y la que me ha dado más satisfacciones.

Además, el tener que leer continuamente todo lo que se está publicando dentro de área hispánica suele darte una visión bastante privilegiada de lo que se está escribiendo en un momento dado. Si no he descartado del todo seguir haciendo crítica, es porque, como te decía, veo al acto de editar como una continuación o prolongación del gesto crítico por otras vías: es una propuesta de escritura/lectura que, como la de una reseña o un artículo, puede ser más o menos acertada y recibir una acogida favorable o desfavorable. Por eso a veces me permito escribir sobre los autores que edito, en revistas españolas o latinoamericanas y aun ocurre que los incluya en algún curso o seminario universitario. Es otra manera de publicar y de compartir una propuesta de escritura/lectura. También me permito escribir sobre autores a los que no edito por una razón u otra, pero cuyas obras me interesan o entusiasman.

grupoeds

De izquierda a derecha: Elizardo Martinez (Ediciones El Callejón), Gustavo Guerrero, Leonora Djament (Eterna Cadencia), Juan Casamayor (Paginas de Espuma), Antonio José Ponte (El Diario de Cuba) y Eduardo Rabasa (Sexto Piso), en marzo de 2016

Fuentes adicionales:

Catherine Fel, «Entretien avec Gustavo Guerrero, responsable du domain hispanophone chez Gallimard», Bureau International de L´Édition Française, marzo de 2009.

Gustavo Guerrero «Vivimos una tendencia a la novelización», entrevista en vídeo en Casa América, 7 de octubre de 2011.

guerreroanagrama

Libro con el que Gustavo Guerrero obtuvo el Premio Anagrama de Ensayo 2008.

Gustavo Guerrero, «La mediación editorial, la traducción y la difusión de las literaturas latinoamericanas en Francia: el proyecto Medet-Lat France. 1950-2000», conferencia en el Seminario Internacional Redes públicas, relaciones editoriales. Hacia una historia cultural de la edición iberoamericana, 22 de noviembre de 2016.

María Pizarro Prada, «4 preguntas a Gustavo Guerrero», en el blog de Iberoamericana/Vervuert, 5 de noviembre de 2012.

Susana Reinoso, «Gallimard y los lectores», publicado en Ñ, y en Función Lenguaje (sin indicación de fecha).

Web sobre la historia de Gallimard, de la colección Du Monde Entier y web de Éditions du Seuil.

 

Carlos Pujol y la movilidad del canon

«Su presencia hizo más humanos a quienes le conocimos –no de todos los sabios podría hacerse este elogio–, y quizás para un humanista esencial no haya misión más alta.»

Carlos Pujol, «En memoria de Joan Petit», La Vanguardia, 21 de septiembre de 1974

Aub1935

Max Aub.

Que el canon literario español del siglo XX no es –afortunadamente– muy estable y fijo es una evidencia. A finales de ese siglo, por ejemplo, se inició un proceso mediante el cual la obra del escritor Max Aub (1903-1972), cuya difusión se vio decisivamente entorpecida por la censura durante todo el franquismo, empezó a ser conocida y, en consecuencia pudo ser reevaluada, y el resultado de ello, en un período relativamente breve, fue que sus obras empezaron a estar disponibles para los lectores españoles, la crítica tanto académica como de actualidad pudo ponderar los valores de esos textos y finalmente empezó incluso a entrar en planes de estudios, con lo que puede decirse que hoy es poco menos que un autor consagrado. La obra de algunos de los muchos escritores exiliados como consecuencia de la guerra civil española y que en sus culturas de acogida tampoco habían entrado en el canon, como Pere Calders, Ramon J. Sender, Francisco Ayala o Rosa Chacel, experimentaron, con mayor o menor éxito, procesos similares una vez enterrado el dictador.

En el caso, notablemente exitoso, de Max Aub, la primera piedra la puso sin duda el traslado en 1985 de la biblioteca, hemeroteca y los riquísimos archivos del escritor a Segorbe, que propició posteriormente la implicación en 1997 de las administraciones públicas en la creación en ese pueblo de la Fundación Max Aub. Paralelamente, otros hitos en este proceso fueron también el congreso celebrado en Valencia en diciembre de 1993 Max Aub y el Laberinto Español, así como las diversas publicaciones que fueron apareciendo en diversas editoriales comerciales (Alba, Calambur, Destino) y que allanaron el camino al inicio de la publicación de las muy voluminosas obras completas de Max Aub y a la traducción de varias de estas obras a diversas lenguas.

carlospujol

Carlos Pujol Jaumandreu.

Al igual que Max Aub, el escritor, traductor y editor barcelonés Carlos Pujol Jaumandreu (1936-2012) nunca llegó a figurar entre los más famosos de su tiempo, en ninguna de sus facetas, pero existen indicios para pensar que eso puede cambiar en un plazo relativamente breve. La donación en marzo de 2016 del archivo personal de Carlos Pujol a la Universitat Internacional de Catalunya (donde Pujol había impartido clases en sus últimos años) dio pie a un doble proceso de catalogación del legado y de difusión de la obra de este polifacético creador literario que, con la profesora de la Facultad de Humanidades Teresa Vallès a la cabeza, dio como primeros frutos la creación de una web, de una cuenta en twiter, la publicación de una de las mejores novelas de Pujol (La sombra del tiempo) y unas jornadas que pusieron de manifiesto no sólo la actualidad de la obra literaria de Carlos Pujol sino también la profunda huella que, como quien no quiere la cosa, dejó en el ambiente editorial español, y muy particularmente en el barcelonés. A medida que el proyecto se desarrolle es de suponer que las cosas irán poniéndose en su sitio.

Junto con reiteradas alusiones a cuán reticente e incluso huidizo se mostraba siempre Carlos Pujol como creador ante los medios de comunicación, en las referidas jornadas se destacaron varios aspectos que prueban la vocación de perennidad de la obra creativa por un lado, y por otro el talento como orientador de lecturas y la agudeza para atribuir los valores pertinentes a los textos que se sometían a su juicio, distinguiendo además con mucha claridad cuándo se trataba de valores estéticos y cuándo de valores comerciales, lo que le permitía ser un crítico literario de referencia y además un editor inestimable en una empresa como Planeta. Su carácter afable, conciliador lo convertían en un hombre idóneo para ocuparse de la secretaría del Premio Planeta, donde además compartió en los primeros años esa labor con quien no se cansaba de reivindicar como su maestro y mentor, Martí de Riquer (1914-2013).

170117-hum-homenatge-carlos-pujol-13

Laureano Bonet.

Del muy influyente Riquer habló también el profesor Laureano Bonet en su intervención, centrada sobre todo en los entresijos de la enciclopedia Larousse en español que puso en marcha Planeta a principios de los sesenta y sobre todo en la creación y desarrollo de la muy célebre Biblioteca Universal Planeta, donde puso de manifiesto la capacidad y el tacto con que Pujol creaba y dirigía los equipos de trabajo a cuyo frente se ponía. Ésta y otras intervenciones pusieron también de relieve el profundo conocimiento de las culturas francesa e inglesa que Pujol tenía, su amplitud de miras, en buena medida procedente de una formación comparatista avant la lettre, consecuencia a su vez de haber cursado Filología Románica.

De su vertiente como creador literario, desdoblado a su vez en la de poeta, el aforista y narrador, se subrayó su concepción de la responsabilidad del trabajo creativo, en el sentido de ofrecer la mejor obra en la medida de las posibilidades del creador, la intención de publicar a toda costa su obra y someterla luego al juicio libre de los lectores, pero cualquiera que lo haya leído un poco sabe que no pondría ningún empeño en promocionarla (del mismo modo que no se esforzaba en promocionarse a sí mismo y que si a lo largo de su carrera recibió codazos de algún arribista, jamás pagó con la misma moneda).

170117-hum-homenatge-carlos-pujol-16-1

Fernando Valls.

La obra, pues, debe defenderse por sí misma, y tal vez no encontrará la mejor acogida entre sus coetáneos, es posible que su aparición coincida con otras de mérito superior o de mayor relumbrón, pero el hecho de haber sido publicada le garantiza –hasta cierto punto– la capacidad para llegar a los lectores que sabrán, en el presente o en el futuro, disfrutarla. Tanto en su vertiente de escritor como en la de editor, Carlos Pujol era un creador que se apartaba de la norma y se distinguía de lo habitual. Quienes en estas jornadas de homenaje se ocuparon de ello o intervinieron en los debates posteriores a las conferencias (Jordi Gracia, Valentí Puig, Andrés Trapiello, Fernando Valls, David Castillo…) coincidieron en señalar que en términos generales ni la prensa periódica ni los ámbitos académicos habían aquilatado hasta ahora el valor de la obra literaria de Pujol, que no ocupaba el lugar que por méritos estéticos se había ganado, del mismo modo que su conocimiento por parte del común de los lectores tampoco era proporcional a su talento. Los mismo podría aplicarse sin apenas correcciones al lugar que ocupa en el ámbito de la historia de la edición, aun cuando su nombre aparezca siempre cuando se analiza la historia del Premio Planeta.

170117-hum-homenatge-carlos-pujol-13-1

Emili Rosales y Dolors Massot.

Ciertamente, el de Carlos Pujol no es un nombre que suelan mencionar habitualmente como modelo los editores más o menos jóvenes pretendidamente independientes que en nuestros días pugnan por ocupar el espacio mediático, y quizás ello, además de al hecho de que desarrollara toda su carrera en una editorial como Planeta, sea en buena parte debido al particular modo en que Pujol ejerció su magisterio: nada de participación en másteres en edición, ni intervenciones estruendosas en encuentros, congresos o simposios de editores, y mucho menos artículos en prensa sobre el métier, libros de memorias ni nada que ni de lejos pueda parecérsele. Y aun así, son legión los editores afortunados que sacaron provecho de sus enjundiosas conversaciones cara a cara, además de intentar aprender de su ejemplo.

En ciertos aspectos, el caso de Carlos Pujol guarda algunos parecidos, con el de otro editor silencioso y modesto de referencia, Paco Porrúa, quien pese a dar nombre a la sala de actos de una conocida librería de Barcelona, no goza del reconocimiento de otros editores de relumbrón y no siempre de méritos equiparables.

170117-hum-homenatge-carlos-pujol-16

De izquierda a derecha: Manuel Borrás (Pre-Textos), Miguel Ángel del Arco (Comares) y José Ángel Zapatero (Menoscuarto).

Programa de las jornadas de homenaje Carlos Pujol, humanista contemporáneo (Universitat Internacional de Catalunya, 16 y 17 de enero de 2017).

Presentación: Xavier Gil, Marta Lagarriga, Josep Crehueras, Aurora Martínez Ezquerro y Teresa Vallès.

Conferencia: José María Pozuelo Yvancos, «Carlos Pujol, humanista contemporáneo».

Conferencia: Andrés Trapiello, «Carlos Pujol, poeta».

Conferencia: Domingo Ródenas de Moya, «Carlos Pujol, novelista».

Coloquio (moderado por Dolors Massot): Ernesto Ayala Dip y David Castillo, «Carlos Pujol visto por la crítica literaria».

Conferencia: Pere Gimferrer, «Perfil de Carlos Pujol».

Conferencia: Manuel Longares, «Carlos Pujol, aforista».

Conferencia: Andreu Jaume, «Carlos Pujol, traductor».

Conferencia: Valentí Puig, «Carlos Pujol, crítico literario».

Coloquio (moderado por Dolors Massot): Laureano Bonet, Josep Mengual y Emili Rosales, «Carlos Pujol, editor y asesor literario».

Mesa redonda (moderada por Fernando Valls): Manuel Borrás, Miguel Ángel del Arco, Daniel Fernández y José Ángel Zapatero: «Hablan los editores».

Clausura: Teresa Vallès y Carlos Pujol Lagarriga.

la-sombra-del-tiempo-i1n13584271

Edición prologada por Pere Gimferrer y con epílogos del autor y de Teresa Vallès (Fundación José Manuel Lara, 2016).

Fuentes:

Jordi Gracia, «Un raro maestro de la ironía», El País, 22 de enero de 2017.

Carlos Sala, «Carlos Pujol, retrato de un humanista sabio», La Razón, 17 de enero de 2017.

Las fotos del homenaje, cortesía de Teresa Vallès.