«Los de abajo», de Mariano Azuela, y la edición chicana

Cuando en 1915 se publicó la primera edición de Los de abajo, Mariano Azuela (1873- 1952) ya había dado a conocer en Lagos de Moreno (Jalisco) unas cuantas obras narrativas, entre las cuales las novelas María Luisa (Imprenta de López Arce, 1907), Los fracasados (Tipografía y Litografía Müller Hnos., 1908), Mala yerba (Talleres de La Gaceta de Guadalajara, 1909), Andrés Pérez, maderista (Imprenta de Blanco y Botas, 1911) y Sin amor (Tipografía y Litografía Müller Hnos., 1912), y además había dejado impresos en algunas publicaciones periódicas, como el semanario de la capital Gil Blas Cómico, varios relatos (además de fragmentos de María Luisa), en ocasiones tras seudónimo.

Mariano Azuela.

Sin embargo, la publicación de la novela por la que ha pasado a la historia, Los de abajo, tal vez pueda considerarse como uno de los más conocidos ejemplos de edición chicana, pues en una versión distinta a la comúnmente conocida apareció por primera vez por entregas en las páginas del periódico El Paso del Norte (El Paso, Texas), dirigido por Fernando Gamiopichi, de quien Stanley L. Robe recogió algunas informaciones en Azuela and the Mexican Underdogs (1979). Según recoge este investigador, hasta 1912 en El Paso del Norte, empresa formada íntegramente por mexicanos, figuró como «editor» T. F. Serrano y como director Gamiochipi, pero después de esa fecha al segundo se le identifica como «editor propietario», y Roba incluso da noticia de los nombres de algunos redactores (unos hermanos Calderón, Ugartechea, etc.) y el nombre de quienes se ocupaban de imprimirla, la Imprenta Moderna, que se identificaba a sí misma como la «Casa editora del único Diario Constitucionalista en ambas fronteras» y que según el testimonio del cajista José Jesús Loera Rivera, empleaba una «prensa de cilindro cuádruplo». Mientras duró la publicación por entregas de Los de abajo, Azuela cobró tres dólares semanales, pero no hay ninguna evidencia de que cobrara nada por la edición en rústica que el mismo periódico se ocupó de hacer poco después.

Mariano Azuela.

Anunciaba El Paso del Norte en su número 1763 de la segunda época, correspondiente al 27 de octubre de 1915: «Los de abajo, novela que hoy empezamos a publicar en forma de folletín, aparecerá lujosamente encuadernada y dentro de pocos días estará a la venta para el público». La publicación en forma de folletín de esta primera versión, subtitulada «Cuadros y escenas de la Revolución actual», se prolongó hasta el 21 de noviembre (veintitrés entregas). Señala también Stanley L. Robe que el texto, compuesto enteramente a mano, contiene numerosas erratas y nada hace pensar que fuera sometido a un proceso de revisión o edición, sino que se iba publicando a medida que se iba componiendo.

Pasó todavía un tiempo antes de que apareciera la edición en volumen, que puede fecharse con bastante exactitud el 5 de diciembre, con numerosas enmiendas ortotipográficas y una tirada de mil ejemplares, pero el propio Azuelo dejó testimonio de la escasísima repercusión que tuvo esta edición, de la que al cabo de un mes se habían vendido sólo cinco copias. Tampoco su presencia en la prensa fue generosa, aunque el 10 y 21 de diciembre la reseñaron Enrique Pérez Arce J. Jesús Valdez, respectivamente, en El Paso del Norte ( para cuyos lectores Los de abajo era ya una novela conocida).

La Papelería y librería Boras en los años veinte.

De regreso a México, y saneada su economía gracias a los derechos de autor de la publicación por entregas en El Universal de Los caciques, en 1920 Azuela decidió hacer una nueva edición de Los de abajo por su cuenta y riesgo en la imprenta Razaster, también de unos mil ejemplares, con la que era más probable que pudiera llegar a los lectores potenciales de su obra, y se comercializó en librerías importantes, como por ejemplo en el céntrico comercio de Andrés Botas (que ya se había hecho cargo de la edición de Andrés Pérez, maderista y más adelante publicaría otras obras de Azuela). Además, en esta ocasión el texto sí fue sometido a una severa reordenación y revisión con las cuales la novela tomó ya la forma con la que, en líneas generales, se hicieron las ediciones sucesivas. Sin embargo, el éxito aún tardaría en llegarle, de un modo un poco singular, y antes de que se produjera aparecieron Los fracasados. Novela de costumbres nacionales (Talleres Linotipográficos de El Pueblo, 1918), Las tribulaciones de una familia decente (folletín de El Mundo, 1918) y Las moscas (Talleres de A. Carranza e Hijos, 1919).

José Vasconcelos.

A una agria polémica desatada en diciembre de 1924 por Julio Jiménez Rueda en las páginas de El Universal con el artículo «El afeminamiento en la literatura mexicana» (en que reprochaba a los escritores mexicanos el aislamiento de la realidad social) debe Azuela el resurgir de su obra a ojos de la crítica y de los lectores mexicanos de su tiempo. A Jiménez Rueda replicó desde el mismo periódico Francisco Monterde con «Existe una literatura mexicana viril», y entró también en liza Victoriano Salado Álvarez («¿Existe una literatura mexicana moderna?», Excélsior). En esta polémica salió a relucir el nombre de Azuela y su novela Los de abajo, lo que llevó a El Universal Ilustrado a publicar una encuesta entre diversos escritores del momento (José Vasconcelos, Salvador Novo, Federico Gamboa, etc.) acerca de este asunto a la que Azuela respondió: «Cuando el alma del pueblo está empapada en lágrimas y chorreando sangre todavía, nuestras lumbreras literarias escriben libros que se titulan Senderos ocultos, La hora de Ticiano o El libro del loco amor», y como consecuencia del impacto del debate El Universal Ilustrado decide hacer una edición en cinco cuadernillos de Los de abajo que aparecen entre el 29 de enero y el 24 de febrero de 1925 (por la que toda la retribución que obtuvo Azuela fueron cincuenta ejemplares), lo que a su vez desató una incontable serie de ediciones piratas e incluso traducciones a otras lenguas.

La llegada a Madrid de Gabriel Ortega como corresponsal de El Universal propició que la novela fuera conocida por algunos de los personajes más importantes e influyentes de la cultura literaria madrileña del momento, como el poeta, dramaturgo y crítico literario Cipriano Rivas Cherif (1861-1967), Manuel Azaña (1880-1940), que ese mismo año 1926 ganó el Premio Nacional de Literatura por Viaje de don Juan Valera, el reputado poeta, crítico y traductor Enrique Díaz-Canedo (1879-1944), el célebre escritor Ramón Maria del Valle Inclán (1866-1936), el compositor y escritor Gustavo Durán (1906-1969), etc., lo que hizo que en 1927 la editorial Biblos publicara Los de abajo, con ilustraciones de Gabriel García Maroto  (1889-1969).

La edición en Biblos.

Al año siguiente aparecía también la edición francesa, traducida por Joaquín Maurín, en las páginas de Monde (como L’Ouragan), coincidiendo también con la primera edición estadounidense (en Brentano’s, y con ilustraciones de José Clemete Orozco) y en 1930 una nueva edición de la traducción de Maurín al frances, titulada Ceux d’en bas, prologada por Valery Larbaud (1881-1957) y aparecida en J. O. Fourcade, casi al mismo tiempo que la primera inglesa, a cargo de Jonathan Cape.

Gabriel García Maroto.

Pero más que el rocambolesco camino al éxito de Los de abajo, lo que resulta particularmente ilustrativo es el fracaso de su primera edición, la que quizá podemos considerar chicana, pues diversos condicionantes pueden contribuir a explicarla. Por un lado, es evidente que el periodo de convulsiones oplíticas y militares en que se publicó no propiciaba que pudiera tener una difusión adecuada, pero además el contexto geográfico y las dificultades de distribución plantean cuestiones más interesantes, sobre todo a la luz del crecimiento paulatino de las ediciones de literatura chicana en Estados Unidos.

La existencia desde la década de 1780 de imprentas en las que se publicaban folletos en español en Boston o Filadelfia, la fundación ya a principios del XIX de cabeceras periodísticas como El Misisipí, El Mensajero Luisianés o de El Mexicano de Texas desde 1813 no bastan para explicar la situación peculiar creada como consecuencia del Tratado de Guadalupe-Hidalgo de 1848 con que se puso vergonzosamente fin a la guerra entre Estados Unidos y México, por el que el segundo, por quince millones de pesos (unos 450 millones de euros de nuestros días), cedía la totalidad de los estados de California, Nevada, Utah, Nuevo México y Texas, así como parte de Arizona, Colorado, Wyoming, Kansas y Oklahoma, estableciendo como frontera el río Bravo.

Joaquín Maurín.

Pasarían aun unos años antes de que apareciera la que está considerada la primera novela chicana, La historia de un caminante (1881), de Manuel M. Salazar, pero no tantos en cuanto a la proliferación de cabeceras que mantenían informados a los habitantes mexicanos de estos territorios, como El Clamor Público (1855-1859), El Comercio Mexicano (1886), El Libre Pensador (1890) o La Crónica (1909); sin embargo, el contexto con que coincide la aparición de Los de abajo lo crea sobre todo la Revolución de 1910 e iniciativas empresariales como las llevadas a cabo por personajes como los hermanos Ricardo, Enrique y Jesús Flores Magón, que en Estados Unidos pusieron en pie, primero en San Antonio y luego en San Luis,  una continuación del periódico Regeneración, al que seguiría luego Revolución en Los Ángeles.

Mariano Azuela fue, podría decirse, un visitante coyuntural de los Estados Unidos, que enseguida regresó a México y que sólo publicó más allá de la frontera Los de abajo para obtener un poco de dinero con el que subsistir esa temporada, entrando en contradicción personal además con  los planteamientos políticos carrancista de quienes estaban al frente de El Paso del Norte. Además, las peculiares circunstancias en que se produjo (y sobre todo se distribuyó) esa primera edición en volumen de la novela hizo que fuese casi imposible que llegara a su público potencial, era una novela a efectos prácticos inexistente hasta que la reeditó en México.

Por todo ello, no parece ni razonable ni adecuado considerar esa novela como literatura chicana, pero en cambio, dadas las circunstancias en que se produjo, la edición sí podría quizá considerarse como un ejemplo bastante singular de edición chicana, lo que lleva a plantearse la conveniencia de distinguir entre «edición chicana» y «edición de literatura chicana» (en ocasiones emprendida ya en el siglo XX por sellos pertenecientes a grandes corporaciones empresariales o a centros universitarios «anglos»). Como dirían en México, está pensativo.

Fuentes:

AA.VV., Diccionario de la literatura mexicana. Siglo XX, Universidad Nacional Autónoma de México- Ediciones Coyoacán- Instituto de Investigaciones Filológicas- Centro de Estudios Literarios, 2000.

Edición en rústica en Biblos.

Stanislas Mbasi, Aproximación sociocrítica a «Los de abajo», de Mariano Azuela, tesis doctoral presentada en la Facultad de Filosofía y Letras de la Universidad de Granada, 2013.

Bernardo Ortiz de Montellano, «Literatura de la Revolución y literatura revolucionaria», Contemporáneos, núm. XXIII (1930), pp. 7-81, recogido en la edición de sus Obras en prosa, preparada por María de Lourdes Franco Bagnouls, Universidad Nacional Autónoma de México, 1988, pp. 236-238.

Marta Portal, «Introducción» a Mariano Azuela, Los de abajo, Madrid, Cátedra (Letras Hispánicas 120), 1989, pp. 9-75.

Stanley L . Robe, «Dos comentarios de 1915 sobre Los de abajo», Revista Iberoamericana, junio de 1975, pp. 267-272.

Stanley L . Robe, Azuela and the Mexican Underdogs, Berkeley-Los Angeles-Londres, University of California Press, 1979.

 

 

Juan Miguel de Mora y su pugna con las agencias literarias españolas

«Hay hombres que luchan un día y son buenos. Hay otros que luchan un año y son mejores. Hay otros que  luchan muchos años y son muy buenos. Pero hay hombres que luchan toda la vida: esos son los imprescindibles.»

Bertolt Brecht

 

La vinculación del grafómano y periodista Juan Miguel de Mora (1921-2017) con España fue suficientemente estrecha e intensa para que, incluso cuando ya tenía a sus espaldas una más que nutrida y exitosa obra publicada, siguiera intentando con ahínco conseguir que se le publicara en ese país, que en buena medida, y con toda justicia, consideraba en parte el suyo.

Si bien nacido en México (de padre mexicano y madre española), con apenas catorce llegó a Madrid procedente de París, donde estaba cursando estudios, y enseguida intentó contribuir a combatir el avance del fascismo, pues ese era el vago propósito que le había llevado a cruzar los Pirineos. Afiliado enseguida a las Juventudes Socialistas Unificadas (JSU), falsifica su edad para alistarse al Quinto Regimiento, y es destinado a la VI Compañía de Intendencia, hasta que se descubre su auténtica edad y, expulsado, empieza entonces a colaborar como periodista en Avance, el órgano de la AJA (Alianza Juvenil Antifascista) creado en septiembre de 1937.

Menos problemas tuvo para alistarse en 1938, cuando todas las manos republicanas eran pocas en la batalla del Ebro, y pasó a la XV Brigada Internacional, adscrita a la 35ª División del 15 Cuerpo del Ejército que comandaba Manuel Tagüeña (1913-1971), quien moriría precisamente en México. Sin embargo, herido de bayoneta, es evacuado a Falset y posteriormente a Barcelona, y luego entra en el Cuerpo de Carabineros y participa en la defensa pasiva de la capital catalana (en las Brigades de Salvament i Desenrunament). Más tarde, como comisario de Compañía (con tan solo diecisiete años), defendió la columna de republicanos que huían del avance de las tropas franquistas y cruzó los Pirineos por La Junquera. Su paso por el tristemente célebre campo de Saint Cyprien fue breve, y una vez escapó de él consiguió a través de la embajada mexicana ser repatriado a México, donde inició una intensa y prolífica carrera como corresponsal de guerra (Japón, Francia, Vietnam, Guatemala, Panamá, etc.).

No contento con ello, desde 1947 hizo incursiones, a  menudo con éxito, tanto en la literatura dramática como en la novela, en la dirección teatral y en la cinematográfica, pero fueron sobre todo sus libros de tema y tono periodístico los que le granjearon mayor popularidad (de Tlatelolco 1968, por ejemplo, se hicieron una treintena de ediciones, con un total de más de cien mil ejemplares vendidos).

La evocación de la guerra civil, de sus camaradas brigadistas, de las clases populares madrileñas y catalanas y de las lecturas que en esos años hizo están muy presentes en buena parte de su obra, y de hecho, tras su maestría en Lenguas Hispánicas en la UNAM, se doctoró en la Universidad Latino-Americana de La Habana en 1951 con una tesis sobre Lope de Vega (más adelante publicaría Notas para un estudio sobre el Fénix de los Ingenios, 1962). Diez años más tarde, en 1961, mientras cubría la guerra del Vietnam, empezó a internarse en el ámbito en el que acabaría por convertirse en una autoridad internacional, la literatura sánscrita, al tiempo que cursaba estudios de literatura vietnamita; pero no tardó en surgirle la oportunidad de regresar a España en una misión a medio camino entre el periodismo y la acción de resistencia.

En 1964, José Pagès Llergo (1910-1989), también corresponsal de guerra (había entrevistado a Hitler tras la caída de Varsovia) y por entonces director de la revista Siempre!, le propuso entrar clandestinamente en España y, con la ayuda de miembros del Partido Nacionalista Vasco, informar de primera mano acerca de los movimientos de resistencia al franquismo en el interior. Como no podía ser de otra manera, en cuanto sus reportajes empezaron a publicarse y a circular, se desencadenó un notable revuelo, la policía española se puso tras sus pasos y el por entonces ministro español de Información y Turismo, Manuel Fraga Iribarne (1922-1912), le dedicó en la prensa española epítetos del calibre de «alimaña», entre otras lindezas. De esa experiencia surgió el libro de reportaje Misión de prensa en España. Un pueblo en lucha heroica, cuya publicación en 1965 (en Comunidad Ibérica, con prólogo de Fidel Miró y epílogo de Aurora Correa) hizo que la Alianza Sindical Española solicitara el gobierno de la República Española en el exilio la Orden de la Liberación de España, que le impuso ese mismo año el presidente Luis Jiménez de Asúa (1889-1970) en un acto celebrado en la embajada de la República en México.

Con estos antecedentes, y aún unos cuantos años antes de la escritura de sus obras mayores sobre la guerra civil española (Sólo queda el silencio, Cota 666 y La libertad, Sancho…), no es de extrañar que a principios de la década de los noventa hiciera confluir su pasión por la literatura clásica española y su experiencia bélica en una novela tan asombrosa y original como El yelmo de Mambrino, de inequívoca y declarada raigambre cervantina, como tampoco es sorprendente que hiciera cuanto estuvo en su mano para que esta novela se asegurara una buena circulación en España. Y de ahí nació un sonado conflicto, en parte como consecuencia de su convicción de que era una novela perfectamente publicable en España. Declaraba acerca de ello en 2002: «Yo no digo que sea una gran novela, pero sí puedo demostrar, y cualquiera puede hacerlo, que hay muchas novelas que quizá no sean peores, pero tampoco mejores, publicadas en España». Cualquiera que la haya leído puede dar fe de la veracidad de este juicio y podría incluso ir bastante más allá.

Mora confió en que el mejor modo de lograr publicar tanto El yelmo de Mambrino como Sólo queda el silencio en España era a través de la agencia literaria Carmen Balcells, y cuando puso las novelas en sus manos las obras fueron objeto de informes favorables, pero pasaba el tiempo, los mecanoscritos pasaban de una oficina a otra y no se concretaba nada. Hasta que finalmente Juan Miguel de Mora se cansó y decidió publicar El yelmo… en México, en Edamex (el 30 de octubre de 1993, según el colofón), y consiguió además que en España se comprometieran a tenerlo El Corte Inglés, además de alguna librería (me consta que una en Pamplona, por ejemplo), pero obviamente la presencia que tuvo en la prensa fue mínima, como él mismo reconocía: «Nadie habló una sola línea de El yelmo de Mambrino, nadie, pero una excepción, perdón, lo mencionaron los Anales Cervantinos, que es una cosa que publican aquí, muy académica. Lo mencionaron en un tono no agresivo, ligero, porque, claro,  no es académico el libro, pero no lo agredieron tampoco, fue una cosa amable, simpática. Pero, ¿quién va a leer los Anales Cervantinos?».

Sin embargo, el desencuentro con Balcells procedió no tanto de este modo de actuar como del asombroso y poco frecuente texto impreso tanto en la cubierta anterior como en la posterior de esta edición, con lo que Mora expresaba su opinión acerca del sistema editorial español. Una franja sobre un llamativo fondo amarillo informa al posible lector: «Esta novela mereció la distinción de ser rechazada, contra el dictamen de algunos de sus propios comités de lectura, por las siguientes editoriales españolas: Seix-Barral, Anthropos, Planeta, Grijalbo-Mondadori, Alianza Editorial, Debate, Muchnik y Plaza y Janés». Y por si no bastara con esto, en la cubierta posterior se reproducía el siguiente pasaje del informe de lectura elaborado por el prestigioso traductor del italiano Atilio Pentimalli, al que se identifica como «dictaminador de varias editoriales españolas»:

En tercera persona al principio, en estilo deliberadamente cervantino, el autor presenta a su personaje, don Gonzalo, para dar enseguida paso a innumerables testigos que dan su versión de alguno o varios episodios de la vida del protagonista. Es reconfortante que un asunto tan trillado, y a veces tan maltratado, como el de la Guerra Civil Española, haya por fin dado una novela fuera de lo común. Las referencias a episodios, sucesos de toda laya, abusos y salvajadas de la contienda están aquí impregnados de humanidad genuina, sin sensiblería ni partidismos.

Esto bastó para que la segunda mayor agencia literaria española se desentendiera de otra novela que tenía en estudio para una posible reedición en España, La fórmula (originalmente publicada en México en 1971 por Grijalbo). No es de extrañar que por su parte Balcells dejara de ocuparse de Sólo queda el silencio, pero para entonces Mora tampoco tenía ya ningunas esperanzas de que sus gestiones llegaran a buen puerto, consideraba el sistema editorial peninsular inmerso en un proceso de degeneración moral  y contaba en la misma entrevista ya citada:

la tuvo la señora Balcells dos años sin mover nada para que se publicara, y yo tengo la copia del fax que me mandó, diciendo que era muy interesante y que se la dejara para ver si se vendía. […] Hubiera sido mucho más honrado decir: «Mire, no me interesa, o no tengo tiempo…», en fin, una cosa así.

La agencia de la señora Balcells agarra un libro de un escritor hispanoamericano y te contesta diciendo: «Su libro es muy interesante. Déjenoslo para trabajarlo». Y luego pasan los años y no hacen absolutamente nada con él, pero lo tiene ahí, sujeto. Es un hecho conocido. Me lo hizo a mí, pero no soy el único, Marco Tulio Aguilera Garramuño denuncio el mismo proceder en [el periódico mexicano] Uno más uno.

Del escritor colombiano afincado en México Marco Tulio Aguilera Garramuño es conocido el, por decirlo de algún modo, desparpajo con que ha expresado sus opiniones, en más de una ocasión polémicas, acerca de diversos autores, agentes y en particular premios literarios, y ciertamente también tuvo sus más y sus menos con la agencia de Balcells, que  hasta en tres ocasiones representó libros suyos; explicaba Aguilera a su particular manera:

Casi toda la institución cultural colombiana y mexicana me ignoran, no existo. Sigo publicando aquí y allá (nunca faltan editores), pero las grandes empresas prefieren decretar mi inexistencia: demasiado problemático, demasiado crítico, incapaz de quedarse callado, ha criticado a todos los grandes y se ha granjeado que se le cierren las puertas (de Alfaguara, Planeta, Plaza y Janés, la agencia Carmen Balcells, etc.) en la nariz.

El caso es que Juan Miguel de Mora tardó un poco más en poder ver publicado en España alguno de sus libros,  pero en realidad el lector español quizás, al fin y al cabo, salió ganando con ello, porque la obra de Mora llegó cuando su estilo estaba ya plenamente afinado, manteniendo la fuerza crítica y la contundencia, pero con una pericia narrativa más desarrollada, como demuestra en Sólo queda el silencio, coeditada por Daga y la Universidad de Castilla-La Mancha, y en particular en La libertad, Sancho… Testimonio de un soldado de las Brigadas Internacionales, coeditado por Edamex y la Universidad de Castilla-La Mancha (2006), aunque no deja de ser una amarga anomalía que no exista una edición española de libros como Misión de prensa en España, Cota 666 (que toma el nombre de la que ocupó en la batalla del Ebro) o Los muertos estaban quietos, por poner sólo unos ejemplos entre la extensa bibliografía de tema español de Juan Miguel de Mora.

Fuentes:

Testimonio de Juan Miguel de Mora en Archivo de la palabra de Albacete.

Manuel Aznar Soler, «Espacio urbano, memoria y violencia en Plaza de las Tres Culturas. Tlatelolco, de Juan Miguel de Mora», en Cerstin Bauer-Funke, ed., Espacios urbanos en el teatro español de los siglos XX y XXI, Hildesheim-Zúrich-Nueva York, Georg Olms Verlag, 2016, pp. 107-136.

José David Cano, «La corrupción, una enfermedad nacional» (entrevista), Cultural de El Financiero, 3 de junio de 2005.

Jorge Carpizo MacGregor, «Solo queda el silencio, algo más que una novela», Etcétera, núm. 387 (2000), pp. 11-13.

Francisco Luis del Pino, «El Ramayana es uno de los monumentos de la literatura sánscrita épica», (entrevista a Juan Luis de Mora y Ludwika Jarocka), Clío, núm 145 (213), p. 195.

Francisco Luis del Pino y Josep Mengual, «Juan Miguel de Mora, la rabiosa independencia del intelectual» (entrevista), Lateral, núm. 87 (marzo de 2002), pp. 11-12.

Olga Harmony, «El movimiento del 68 en el teatro mexicano», Tramoya, núm. 31 (abril-junio de 1992), pp. 86-105.

Lise Landon, «Introducción» a Juan Miguel de Mora, La libertad, Sancho…, México, Edamex. Libros para Todos, 2006.

Emilio Martínez Espada, «Nos visita uno de los últimos brigadistas supervivientes: Juan Miguel de Mora», Diariocrítico, 3 de enero de 2014.

Arturo Mendoza Mociño, «Para vivir mucho hay que ir a la guerra» (entrevista), Cultura (suplemento de Reforma), 8 de marzo de 1997, p. 1.

Josep Mengual, «Juan Miguel de Mora, un exiliado incógnito», en El exilio teatral republicano de 1939, Sant Cugat del Vallès, GEXEL, 1999, pp. 277-286.

Juan Carlos Ruiz V., «Marco Tulio Aguilera Garramuño: “Los grandes premios literarios están casi todos viciados”», La Vanguardia, 1 de enero de 2011.

Rafael Solana, «Los héroes no van al frente, de Juan Miguel de Mora», en Noches de estreno, México, Oasis, 1963, pp. 118-120.

Marco Tulio Aguilera Garramuño, «El infame oprobio de los años», Otro Lunes. Revista Hispanomericana de Cultura.

Juan Miguel de Mora y el que suscribe, a principios de los años noventa.

Precedentes del primer gran grupo editorial español (la CIAP).

logociapsEntre los últimos años de la década de los veinte y los primeros de la siguiente, la Compañía Ibero Americana de Publicaciones se constituyó en el primer gran grupo editorial mediante la voraz compra de cabeceras de revistas (La Gaceta Literaria), editoriales (Renacimiento, Mundo Latino, Ediciones Atlántida, Hoy, Mercurio, Estrella), librerías (la Librería Fe y sus diez subsidiarias) e incluso creó grandes imprentas y talleres, así como con el diseño de una enorme red de distribución de todo tipo de material impreso, que además obtuvo en exclusiva la distribución de editoriales de avanzada pujantes como Zeus, Ulises o Signo. Es evidente que la Compañía Anónima de Librería, Publicaciones y Ediciones (Calpe), creada en 1918 por Papelera Española, se puede considerar un intento más sostenido de crecimiento en la misma dirección, pero en la base de la CIAP, con una política más agresiva (y apresurada), se encontraba una curiosa empresa puesta en pie por un audaz periodista e historiador jerezano Manuel L.[uis] Ortega Pichardo (1888-1943).

Con apenas veintiún años, Ortega Pichardo empieza a actuar ya en 1909 como director de una cabecera aún hoy en activo, el Diario de Jerez, periódico creado por los hermanos José y Federico Joly Höhr, y poco después publicaba una primera compilación de críticas políticas y literarias con el título Frivolidades (1910), a la que seguiría el año siguiente otra de artículos costumbristas, El amor y la vicaría, películas de cine (Diario de Jerez, 1911) y más adelante La vida que pasa (Empresa Editora Andalucía, 1916). En los años siguientes, además de cubrir como corresponsal la conocida como Guerra del Rif, dejaría una estela de diarios y publicaciones periódicas, pero quizá una de las más interesantes en relación a la CIAP sea la Revista de la Raza. Publicación de Estudios Internacionales (1915-1930), creada en colaboración con Ignacio Bauer Landauer, hijo (y heredero) del banquero Gustavo Bauer Morpurgo (1865-1916), representante a su vez de los Rothschild en España.

ortegapichardo

Manuel L. Ortega Pichardo.

Entre algunas de las curiosidad que a lo largo de su historia publicó la Revista de la Raza, se cuenta una breve obra narrativa titulada «En los tentáculos de los siglos» y firmada con el seudónimo Isabel Inghirami, que es el que empleaba al principio la escritora María Teresa León (10903-1988) (número 119, febrero de 1925, pp. 18-19), o también diversos artículos de la escritora y periodista Carmen de Burgos (1867-1932), en ambos casos ya a principios de los años veinte. A partir precisamente de 1924 esta cabecera se convertiría en la portavoz de la Liga Internacional de Mujeres Ibéricas e Hispanoamericanas, y serían frecuentes en sus páginas las firmas de Ana de Castro Osorio (1872-1935), Emilia de Sousa Costa, (1877-1959), Micaela Díaz Rabaneda (1827-1931), Elena de Arizmendi (1884-1949), María de La Rigada, Nurie Gabay de Estrugo, etc.

logoiberoafroSin embargo, antes de acabar la segunda década del siglo XX, Ortega Pichardo había creado una Editorial Ibero-Africano-Americana que, por lo menos desde 1917, se había ocupado de publicar en Marruecos unos anuarios que se presentaban como la «guía oficial de Marruecos», y en esa misma fecha aparece en una Colección Hispano-Marroquí de la misma editorial España en Marruecos: el Raisuni, firmada por el propio Ortega Pichardo. Al año siguiente aparecía en la misma colección e impreso en la Tipografía Moderna el que sin duda es el título más conocido del prolífico Ortega Pichardo, Los hebreos en Marruecos. Estudio histórico, político y social, que en la primera edición incorporaba un prólogo del alto comisario de España en Marruecos Francisco Gómez Jordana (1852-1918) y que tuvo diversas reediciones (CIAP, 1929, con prólogo de Pedro Sáinz y Rodríguez; reimpreso en la Ediciones Nuestra Raza, 1934) antes de que en 1994 la reeditara Algazara con prólogo del historiador Víctor Morales Lezcano.

Por esos mismos años parece que la editorial va cobrando envergadura, quizás gracias a la colaboración de Ignacio Bauer. Así, en 1920 se publica una edición de El Diablo Mundo, de José de Espronceda, acompañado de un juicio crítico del hispanista escocés James Fritzmaurice-Kelly (1858-1923); en 1922, una biografía del por entonces aún vivo doctor y senador vitalicio Ángel Pulido Fernández (1852-1932) Figuras Ibéricas, escrita por Ortega Pichardo y prologada por Ignacio Bauer, que aparece en una Biblioteca Hispano-Sefardí, y también de 1922 son tres libros preparados por Ignacio Bauer: los seis volúmenes recopilatorios de las Relaciones de África, los Apuntes para una bibliografía de Marruecos y la Carta de Roma. Don Juan de Zúñiga a Felipe II (1577); de 1923 son los Apuntes para la historia de las cofradías musulmanas del arabista y diplomático Clemente Cerdeira Fernández (1887-1942), y del año siguiente El convidado de piedra, de Tirso de Molina, que ejemplifica una de las derivas que empieza a tomar ya la editorial en esos años, la publicación de obras clásicas españolas.

sainzrodriguez

Pedro Sainz Rodríguez.

En noviembre de 1924 se produce un acontecimiento que lo cambia todo: la constitución de la CIAP (que se escritura ante notario el 28 de enero de 1925). Entre sus fundadores, Ignacio Bauer Landauer (presidente), José Francos Rodríguez, Antonio Goicoechea y Alberto Bandelac de Pariente (como vicepresidentes), Manuel Luis Ortega Pichard (como consejero delegado y director gerente), Pedro Sainz Rodríguez, (consejero y director literario) e Isaac Toledano, José Arango, Rodrigo Saavedra Vinent, Ángel Arpón de Mendívil, Carlos E. Montañés, Menhakent Coriat y Jacques Bentata como consejeros.

En un muy detallado y completo artículo acerca de la trayectoria de la CIAP, Miguel Á. López-Morell y Alfredo Molina Abril hacen una perfilada caracterización de este grupo fundacional y de las consecuencias del mismo:

En el primer Consejo de Administración y en sus posteriores incorporaciones destacó, como ha mostrado Molina, un significativo grupo de personas vinculadas a la comunidad judía norteafricana, como Toledano, Coriat o Bandelac, junto a personalidades importantes de la vida cultural madrileña, como los exministros Goicoechea y Francos Rodríguez, presidente este último de la Asociación de la Prensa, o los catedráticos universitarios [Rafael] Altamira y Sainz Rodríguez, interesados también en las relaciones con la comunidad judía o en el estudio de la influencia cultural hebrea, lo que reportaría a la institución algunas críticas de sectores filorracistas y ultraconservadores en los años siguientes.

perraultAun así, parece ser que la Editorial Ibero-Africano-Americana siguió una trayectoria más o menos paralela pero independiente a la de la CIAP, sin integrarse a ella, y en los años siguientes continuaron apareciendo títulos bajo ese sello, entre los que se cuentan, por ejemplo, una traducción de Agustín Aguilar de La vida amorosa de Luis XIV (1926), de Louis Bertrand (186-1941), en una colección llamada Los Amores, donde se publica también una traducción de Rafael de Morales de La vida amorosa de Casanova (1926), de Maurice Rostand; una traducción no firmada de los Cuentos de viejas (1928) de Charles Perrault prologada por Ignacio Bauer con la que se estrenaba una colección de Las Cien Mejores Obras de la Literatura Universal, que tenía también una equivalente en Las Cien Mejores Obras de la Literatura Española, donde se publica un Lazarillo (1927) prologado por uno de los historiadores que colaboraban asiduamente en la Revista de la Raza, Rodolfo Gil Benumeya (1901-1975) o, incluso una vez ya desmembrada la CIAP, una monumental Colección de documentos inéditos para la historia de Ibero América, 1927-1932 publicada en catorce volúmenes en 1934 bajo la dirección de Rafael Altamira, que no había tardado en entrar en el consejo de administración de la CIAP.

wallacenuestrarazaDe todos modos, el momento que suele señalarse como el arranque de la expansión de la CIAP, el año 1928, va precedido de una cesión de relativa importancia, por lo menos por las consecuencias que tiene en las cabeceras que se ven afectadas por ella. En los últimos meses de 1927, Ortega Pichardo cede a la CIAP, junto a la Guía de Balnearios y Casas de Descanso de España, la Revista de la Raza, en la que por esos tiempos la sección «Mundo Sefardí» ocupaba un tercio de la revista y en la que colaboraba con más o menos asiduidad, Alejandro Lerroux, Niceto Alcalá-Zamora o José Antonio de Sangróniz.

Durante la etapa de expansión de la CIAP, además de la Revista de la Raza, tiene continuidad pues la Editorial Ibero-Africana-Americana, e incluso  una vez que la CIAP se empieza a saldar el stock en 1931 siguen apareciendo algunos títulos, cabe suponer que debido a que Ortega Pichardo mantuvo la propiedad del sello sin vincularlo a la CIAP. Por otra parte, en unas llamadas Ediciones Nuestra Raza aparece, por ejemplo, la edición ya mencionada de Los hebreos en Marruecos prologada por Sainz Rodríguez en 1934, o al año siguiente el Maimónides, un sabio de la Edad Media, de Ignacio Bauer, en una colección llamada Los Hombres de Nuestra Raza, y Las pinturas negras de Goya, del crítico literario y por entonces patrono del Museo Municipal de Madrid Emiliano M.[artín]. Aguilera (1905-1975), así como El Zohar en la España musulmana y cristiana, de Ariel Bension (1880-1932), con prólogo de Miguel de Unamuno (1864-1936), o textos que previamente habían aparecido en la Biblioteca Cervantes de la CIAP, como una edición de La Política de Aristóteles, las Doloras, poemas y humoradas, de Ramón de Campoamor, seleccionadas por Agustín Aguilar, o los dos tomos de la Historia de los movimientos, separación y guerra de Cataluña, que el escritor y militar portugués Francisco Manuel de Melo (1608-1666) había firmado como Clemente Libertino.

nuestrarazaPor el camino, Ortega Pichard había creado diversas publicaciones periódicas (El Heraldo de Marruecos en Larache y el ceutí Mediterráneo, ambos en 1925), y posteriormente, durante la guerra civil, como conocido monárquico, fue objeto de persecución, encarcelamiento, enviudó en 1938 y se refugió en la embajada de Finlandia. Esteban Salazar Chapela, que trabajó unos años en la CIAP y a quien Ortega Pichard había presentado a Unamuno, ofrece la siguiente explicación de cómo se salvó el editor jerezano en su novela en clave En aquella Valencia:

–Socorrito y yo –le dije a Palomino– trabajamos juntos unos años en la editorial Carabela [CIAP]…

–Hombre, la Carabela –contestó Palomino–. El gerente de esa editorial, don Manuel Picazo [Ortega Pichardo], estuvo si lo pasean o no lo pasean. Se salvó por chiripa, no sé si usted lo sabe.

–No he sabido nada de él desde mucho antes de la guerra.

–Sí, estuvo en capilla y lo sacó de allí ese escritor de teatro… ¿cómo se llama?, ese escritor que estrenó dos obras que hicieron mucho ruido, Santa Isabel de Ceres, Los gorriones del Prado…

– [Alfons] Vidal y Planas.

–Ése. Él me lo contó pocos días antes de venirme a Valencia. Desde su prisión, donde ya llevaba dos días, don Manuel consiguió enviarle unas líneas a Vidal y Planas. Este Vidal es un anarquista de lo más sentimental, bondadoso y puro que puede darse.

[…]

Como les decía, Vidal recibió las líneas, corrió al sitio donde tenían metido a don Manuel y preguntó a sus correligionarios, pues todos eran allí anarquistas: «¿Y por qué lo vais a matar? Este hombre no se ha metido en nada ni es peligro ninguno para la causa» «Pero sabemos (le explicaron) es un inmoral…». Lo iban a matar por inmoral. La réplica de Vidal fue muy buena: «Compañeros, si vamos a matar en España a todos los inmorales no quedaremos nadie para contarlo». El razonamiento surtió efecto y le dieron el preso.

nraza

La carabela que aparece tanto en el logo de la CIAP como en el de las Ediciones Nuestra Raza sirve a Salazar Chapela para asignar el nombre en clave a la editorial en su novela.

Casado en segundas nupcias con la hija de un militar, Mery del Olmo, Ortega Pichardo moriría apenas cuatro años después del final de la guerra.

Fuentes:

eslabonLuisa Carnés, El eslabón perdido, edición de Antonio Plaza Plaza, Sevilla, Renacimiento (Biblioteca del Exilio 9), 2002.

Francisco Fuster García, «Compañía Ibero Americana de Publicaciones (CIAP)», en Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIX-XXI) – EDI-RED.

José Luis Jiménez García, «El periodista jerezano Manuel Luis Ortega Pichardo, autor del libro Los hebreos en Marruecos», Tarbur Sefarad, 10 de agosto de 2010.

Miguel Ángel López-Morell y Alfredo Molina Abril, «La Compañía Iberoamericana de Publicaciones, primera gran corporación editorial en castellano», Revista de Historia Industrial, núm. 49 (febrero de 2012), pp. 111- 145.

Jesús A. Martínez Martín, dir., Historia de la Edición en España, 1836-1936, Madrid, Marcial Pons, 2001.

enaquellavalenciaFrancisca Montiel Rayo, Esteban Salazar Chapela en su época: obra literaria y periodística (1923-1939), tesis doctoral leída en la Universitat Autònoma de Barcelona en 2005.

Francisca Montiel Rayo, «Esteban Salazar Chapela (Málaga, 190- Londres, 1965)», en Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIX-XXI) – EDI-RED.

Julio Saez Angulo y Dolores Gallardo, «Manuel Luis Ortega Pichardo, periodista, escritor y editor de la CIAP», La Mirada Actual, 23 de enero de 2011.

Esteban Salazar Chapela, En aquella Valencia, edición de Francisca Montiel Rayo, Sevilla, Renacimiento (Biblioteca del Exilio 4), 2001.

 

La Editorial Rocas y el «descubrimiento» de Vargas Llosa

vargasllosajovenEl descubrimiento de Mario Vargas Llosa (n. 1936) ha quedado comúnmente asociado a la obtención del Premio Biblioteca Breve en 1962 con La ciudad y los perros (1962), que luego ganaría también el Premio de la Crítica, y a la labor de difusión que de su obra llevaron a cabo con tesón la agente Carmen Balcells (1930-2015) y el editor Carlos Barral (1928-1989).

Sin embargo, quienes por primera vez le permitieron entrever la posibilidad de acabar convirtiéndose en escritor profesional fueron los editores de la barcelonesa Editorial Rocas, que por aquel entonces estaba consiguiendo prestigiar un galardón destinado a libros de cuentos literarios, el Premio Leopoldo Alas, mediante el cual esta singular empresa se estaba haciendo con un cierto renombre entre las jóvenes promesas del género. La idea surgió de un grupo de curiosos escritores vinculados muchos de ellos profesionalmente a la medicina: el especialista en obstetricia y ginecología Martín Garriga Roca (1900-1980); el estomatólogo Esteve Padrós de Palacios (1925-2005), que se había iniciado como ayudante de Garriga en la asistencia a partos a domicilio, el también ginecólogo Manuel Carreras Roca (1915-1997), quien antes de la guerra se financió los estudios como futbolista del Llevant y el València, y el crítico literario y poeta Enrique Badosa. A Badosa y Padrós atribuyó específicamente Vargas Llosa la posibilidad de publicar su primer libro, y en realidad la Editorial Rocas, y muy particularmente la Colección Leopoldo Alas, de cuentos, dio a conocer algunos otros nombres importantes o apoyó de un modo decisivo a jóvenes narradores que no tardarían en destacar en la segunda mitad del siglo XX.

12cuentos

La mencionada colección se había estrenado en 1956 con 12 cuentos y 1 más, con el que se da a conocer Lauro Olmo (1921-1994), quien sin embargo ya había publicado en colaboración con Pilar Enciso (1919-2000) El león engañado y Cuno (en la colección Literatura de Juglaría, Madrid, Gráficas Bachende) y el poemario Del aire (en la colección Neblí que dirigían Rafael Millán y Felipe García Ibáñez) y quien poco después se ganaría un lugar destacado en la historia de la literatura española en el terreno de la literatura dramática (La camisa, 1960; La pechuga de la sardina, 1962; English Spoken, 1967, etc.). Entre las curiosidades de este volumen se cuenta un muy buen prólogo de Enrique Badosa y la indicación de la barcelonesa calle Ausias March, número 31 (esquina calle Girona), como sede de la editorial, pues coincide con el domicilio de la clínica en la que trabajaban Esteve Padrós y su hermano Eduard, y donde previamente había tenido la suya su padre, el oftalmólogo Jaume Padrós de Gaona (1885-1943). Según reza en la página 5 de este volumen, impreso en Socitra y encuadernado en rústica:

Doce cuentos y uno más, de Lauro Olmo, fue galardonado con el I Premio Leopoldo Alas para libros de cuentos literarios en Barcelona la noche del día 3 de marzo de 1956, por un jurado compuesto por don Martín Garriga, don Manuel Carreras, don Gonzalo Lloveras, don Manuel Pla y Salat, don Miguel Dalmau Ciria, don Juan Planas Cerdá, don Esteban Padrós de Palacios y don Enrique Badosa.

lauroolmo

La familia Olmo al ser deshauciados de Las Pozas en noviembre de 1972.

No deja de tener su interés y su punto subversivo la reivindicación del escritor Leopoldo Alas (1852-1901) implícita en el nombre elegido para el premio y la colección, pues vale la pena recordar que la obra magna de este autor, la novela La Regenta, estuvo prohibida por la censura franquista durante muchos años, y justo por aquel entonces, ese mismo año 1956, al editor Alfredo Herrero Romero (1924-1974) se le denegó la autorización de publicarla alegando en el informe de censura que «los verdaderos protagonistas de la obra son la simonía y la lujuria, que convierten un bellísimo idilio digno de Santa Teresa o San Juan de la Cruz en un torbellino de lascivias sacrílegas».

El tercer número de la colección Leopoldo Alas (el segundo es una antología de cuentos presentados al premio) lo ocupó en 1957 un libro de quien obtuvo el premio homónimo en su segunda convocatoria, Jorge Ferrer-Vidal Turull (con Sobre la piel del mundo, prologado por Padrós), quien en 1954 había despertado la atención de la crítica con la novela El trapecio de Dios, aparecida en la lujosa colección de Josep Janés (1913-1959) La Botella Errante. Y a este le seguirían, antes de la aparición de Los jefes, las primeras obras de una serie de autores que pueden más o menos inscribirse en un tipo de realismo de crítica social: La noticia (1958), de Manuel San Martín (1930-1963), quien dos años después sería finalista del Premio Planeta con El borrador (1960); Los desterrados (1958), de Ramon Nieto (n. 1934), que previamente había publicado sólo La Tierra y que en años posteriores desarrollaría una amplia labor editorial (en Santillana, Altea, la Unesco, Salvat, Alhambra); Aljaba, de Esteve Padrós, La rebusca y otras desgracias (1958), con el que se estrenaba en las letras de molde Daniel Sueiro (1931-1986), que al año siguiente obtendría el Premio Nacional de Literatura con Los conspiradores (reeditado en Menoscuarto en 2006) y Muertos y vivos, de Julián Gállego (1919-2006), que años más tarde ganaría el Leopoldo Alas con Apócrifos españoles (1967).

kurtzcamino

En un díptico sobre las primeras publicaciones de la colección, Eduardo Tijeras hacía un primer intento de señalar la tendencia predominante en esta colección de la Editorial Rocas, en unos términos muy de época y hoy bastante sorprendetes, y en la que se inscribiría Los jefes:

En lo referente a modismos dialogales, [Ferrer-Vidal] sigue una tendencia parecida a la de Olmo (recurrimos a la comparación para fijar y unificar de algún modo tales conceptos), es decir, que ambos gustan de poner en boca de sus personajes expresiones populares, barriobajeras, libertarias [sic] y magnetofónicas, lo que se ha venido en denominar realismo objetivo o cinematográfico, y que son, desde luego, acusadoras de un estado social vigente.

Y al libro inaugural del joven escritor peruano le seguirían otros libros no muy alejados de esta línea firmados por nombres tan notables como los de Víctor Mora (1931-2016), Ana María Matute (1925-2014), Carmen Kurtz (1911-1999) o Ignacio Aldecoa (1925-1969) entre los más destacados.

arrepentidamatuteEste es el contexto en el que se publica, pues, el primer libro de cuentos de Vargas Llosa, originalmente con prólogo de Joan Planas Cerdà, un dibujo de Clara Guillot y tan sólo cinco cuentos («Los jefes», «El desafío», «El hermano menor», «Día domingo» y «El abuelo»). El que habitualmente suele incorporarse en ediciones recientes, «Un visitante», se publicó por primera vez en la edición de la limeña Populibros Peruanos en 1963 en sustitución de «El abuelo», y fue en la edición también limeña de José Godard Editor cuando por primera vez el libro tomó la forma con que hoy es conocido, acogiendo los seis cuentos mencionados.

De escritura posterior a «Los jefes», «El abuelo» es sin embargo el primer cuento que había publicado Vargas Llosa, en las páginas de El Dominical del periódico de Lima El Comercio, el 9 de diciembre de 1956, y acerca del que posteriormente diría:

«El abuelo» desentona en este conjunto de historias adolescentes y machistas. También él es residuo de lecturas —dos bellos libros perversos de Paul Bowles: A delicate Prey y The Sheltering Sky— y de un verano limeño de gestos decadentes; íbamos al cementerio de medianoche, adorábamos a Poe y, en espera de hacer algún día satanismo, nos consolábamos con el espiritismo.

losjefesEn febrero del año siguiente «Los jefes», que el autor describió luego como «un eco desafinado de L’espoir de Malraux, que iba leyendo mientras lo escribía», apareció en forma de separata de la longeva revista Mercurio Peruano (fundada en 1918) que en aquellos años dirigía el reputado historiador peruano César Pacheco Vélez (1929-1989). Tampoco era inédito «El desafío», cuya historia editorial es un poco más compleja y se inicia cuando en 1957 lo presenta a un galardón convocado por la Revue Française y se lleva el premio (consistente en un viaje a París). Su primera aparición pública la hizo este cuento en el número 98 la mencionada revista en la traducción al francés llevada a cabo por el profesor André Coyné (1927-2015) y revisada por Georgette Marie Philippart Travers (1908-1984), más conocida como Georgette Vallejo por el hecho de ser la viuda de César Vallejo y haber logrado mantener a salvo y conservar a través de dos guerras (la civil española y la segunda mundial) el legado del poeta César Vallejo (1892-1938).

A estos tres cuentos añadió Vargas Llosa otros dos escritos más o menos por esos mismos años en el envío que desde Madrid preparó como candidatura al Premio Leopoldo Alas en su edición de 1958, en la que se alzó como vencedor y, según confesaba a Xavi Ayén, eso le decidió a tomar la seria determinación de hacerse escritor, y en términos muy similares se expresó en una entrevista con Leandro Pérez Miguel: «Ahí empezó mi vida de escritor, al menos oficialmente. Creo que [Los jefes] es un libro donde se ve una personalidad en proceso de formarse. Los jefes es un pequeño microcosmos de lo que vendrían a ser el resto de mis libros».

Es posible que la primera mención que aparece en prensa de la inminente aparición de este volumen sea la que se publicó en el número 115 de Cuadernos Hispanoamericanos (julio de 1959) del ya mencionado Eduardo Tijeras, que contiene una hoy chocante errata precisamente en el nombre del por entonces autor novel: «El último premio Leopoldo Alas, concedido recientemente al libro Los jefes, de Mariano Vargas, aún no ha visto la luz pública».

badosa

Enrique Badosa.

Sin embargo, los cuentos de ese joven peruano de veintipocos años reunidos en Los jefes están más cerca del estilo que caracterizaba las propuestas de la Editorial Rocas que de los derroteros que iría tomando la narrativa de Vargas Llosa en los años inmediatamente posteriores. Si bien es poco cuestionable el parentesco entre los ambientes, las atmósferas, los personajes e incluso los temas presentes en estos cuentos y los que aparecen en obras como La ciudad y los perros (1963) o Los cachorros (1967), uno de los más perspicaces miembros del jurado que le galardonó, Enrique Badosa, identificó retrospectivamente el que tal vez sea principal rasgo que marca un hiato entre este libro inicial y los posteriores, durante una conversación del autor con varios editores barceloneses en 1967:

En su primera obra, Los jefes […] emplea usted un estilo que se podría denominar convencional; esto es, un estilo en el que, desde fuera de la obra, el narrador describe personajes, hechos y diálogos. En Los cachorros, por el contrario, usted se sitúa, por así decirlo, en el seno mismo de lo relatado, más casi como sujeto paciente de su literatura que como sujeto agente. Por otra parte, en Los jefes la originalidad creadora era buscada, sobre todo, en la novedad del argumento, mientras que en Los cachorros esa originalidad se busca más en el cómo se dice lo que se dice.

Es muy conocido, porque se ha repetido muchas veces, que la sugerencia de presentar su segunda obra a Carlos Barral le llegó a Vargas Llosa en París a través del hispanista Claude Couffon (1926-2013), quien consideraba al por entonces director de Seix Barral el único capaz de conseguir que La ciudad y los perros pasara sin daños excesivos por la censura española, pero en cualquier caso es evidente que, debido a la línea editorial de Rocas, centrada en el cuento realista con un componente de crítica social, la evolución del escritor peruano no hubiera tardado en desentonar en el catálogo de quienes le descubrieron como narrador.

Aun así, el galardón y la publicación a Los jefes, añadida a la de obras primerizas de tantos otros autores que no tardarían en consagrarse mediante premios de mayor relumbrón, son muy indicativos del buen olfato y la intuición del grupo que gestionaba la Editorial Rocas, capitaneado por Enrique Badosa, quien poco después se convertiría en una de las piezas importantes de la editorial Plaza & Janés, sobre todo como director del departamento de Lengua Española y de las colecciones Selecciones de Poesía Española y Selecciones de Poesía Universal.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

El grueso de los autores del boom en Barcelona. Al fondo a la izquierda, al lado de Barral, puede verse a Vargas Llosa.

Fuentes:

Xavi Ayén, «Vargas Llosa: “Barcelona me hizo escritor”», La Vanguardia, 10 de octubre de 2010.

Enrique Badosa, Juan Ramón Masoliver, Joaquín Marco, Esther Tusquets, Carlos Barral y Jose María Castellet, «”Realismo” sin límites. Vargas Llosa, diálogo de amistad», Índice, núm. 224 (octubre de 1967, pp. 21-22. Recogido en Joaquín Marco y Jordi Gracia, eds., La llegada de los bárbaros. La recepción de la narrativa hispnoamericana en España, 1960-1981, Barcelona, Edhasa (El Puente), 2004, pp. 479-484.

Ernesto Mauri, «En recuerdo de Esteban Padrós de Palacios», Luke, núm. 97 (junio de 2008).

Leandro Pérez Miguel, «Mario Vargas Llosa: “Los jefes es un microcosmos del resto de mis libros”», El Mundo, 11 de agosto de 1999.

Eduardo Tijeras, «Noticia sobre el Premio Leopoldo Alas», Cuadernos Hispanoamericanos, núm. 115 (julio 1959), pp. 68-72.

Eduardo Tijeras, «Segunda noticia sobre la colección Leopoldo Alas», Cuadernos Hispanoamericanos, núm. 125 (mayo 1960), pp. 236-238.

Mario Vargas Llosa, «Acerca de mis primeros cuentos», en Lauro Zavala, ed., Teorías del cuento II: La escritura del cuento, México, Universidad Nacional Autónoma de México, Textos de Difusión Cultural. Serie El Estudio, 1995, pp. 207-212.

 

El acto de editar como acto de escritura/lectura. Entrevista a Gustavo Guerrero

Gustavo Guerrero (Caracas, 1957), profesor universitario, crítico literario y ensayista, escritor y consejero literario para el ámbito de la lengua española en Gallimard, desde hace ya varios años ha asistido desde una posición privilegiada a los procesos de internacionalización de la literatura española y latinoamericana, en los que París ha desempeñado un papel fundamental.

expo-sarduyguerrerowal176

Gustavo Guerrero y el editor François Wahl (1925-2014).

Llegas a París, habiéndote graduado en Derecho en la Universidad Andrés Bello, ¿qué te lleva a París?

En realidad, el viaje a París supuso una ruptura. Durante mis últimos años en Caracas vivía una doble vida: de día era un joven abogado especializado en derecho financiero (trabajaba en la colocación de bonos de la deuda pública en los mercados extranjeros) y de noche escribía reseñas y notas bibliográficas para el suplemento literario del periódico El Universal (por entonces uno de los más importantes de Venezuela) y también para otras publicaciones nacionales y extranjeras (entre ellas, la famosa Vuelta de Octavio Paz). Llegó un momento en que se hizo imposible seguir sirviendo a estas dos coronas.

genette

Gérard Genette (París, 1930).

La Fundación para la Cultura y las Artes de Caracas me ofreció una salida al otorgarme una beca de estudios en teoría y crítica literaria sobre la base de un dosier formado por mis artículos. Así salí de Venezuela y del mundo del derecho; así llegué a París y al departamento de teoría literaria de la Escuela de Altos Estudios en Ciencias Sociales. Pero el derecho y las finanzas no desaparecieron del todo. Han sido, por el contrario, dos herramientas esenciales para ejercer cabalmente el oficio de editor.

Cuando entras en la Escuela de Altos Estudios en Ciencias Sociales, Gerard Genette (n. 1930), que dirigió tanto tu licenciatura como tu doctorado, era ya una estrella de los estudios literarios, pero en 1982, justo cuando tú te diplomas, publica un ensayo tan influyente como el Palimpsestos. ¿Qué puedes contar del Genette profesor y de su influencia sobre tu modo de afrontar la literatura? Porque creo que proponía, sobre todo en Figuras III, un método de análisis de textos literarios muy útil y productivo.

Palimpsestos fue primero un seminario de dos o tres años en la Escuela, y luego una lectura capital. ¿Qué decía Genette en ese libro? Afirmaba que el sentido de una obra literaria no dependía de la sola estructura de su texto (algo que en aquel entonces aún parecía bastante herético) sino que variaba en función del entorno de ese texto y, en particular, de la manera como el objeto libro, a través de sus cubiertas, ilustraciones, cuartas de forro, solapas, etc., trataba de inducir o incluso de imponer una cierta interpretación. Para mí fue el descubrimiento de que el acto editorial podía ser un acto de escritura/lectura que implicaba la imposición de un sentido y secretaba (o trataba de secretar) un horizonte de recepción determinado. Editar era algo más que hacer libros; era conferir un sentido, formular una propuesta de lectura.

¿Cuáles eran tus experiencias editoriales cuando llegas a Gallimard?

logoduseuil

Logo de Éditions du Seuil, obra de Robert Lapoujade, que reproduce su sede entre 1945 y 2010: rue Jacob, 27.

Es una historia un poco larga. Antes de entrar a Gallimard, estuve trabajando durante tres años en Editions du Seuil. Allí me inicié en el oficio, junto a Severo Sarduy y a François Wahl. Todo partió de Genette, que también formaba parte del equipo de le Seuil (por entonces dirigía la colección Poétique). Recuerdo que el tema de mi tesina en la Escuela fue el concepto de neobarroco en la obra de Sarduy. Gracias al apoyo de Andrés Sánchez Robayna, ese trabajito universitario, algo retocado, se editó en Barcelona con el título rimbombante de La estrategia neobarroca (1988). Pero antes de que se publicara, Genette se lo envió al propio Sarduy y éste se lo dio a leer a François Wahl, que era como el gran mandarín de toda el área de humanidades y ciencias sociales en la editorial. Ambos me propusieron que leyera y redactara informes para las colecciones de literatura extranjera.

Fueron unos años inolvidables. Se trabajaba muy a gusto, dentro de un clima de efervescencia, camaradería e informalidad. Todavía soplaban los vientos libertarios del mayo francés por los corredores de la casita de la rue Jacob. Cada libro se leía y se discutía con rigor, con apasionamiento, como si todos participaran en una misma aventura literaria, cultural y política. Redactar un informe era como realizar un ejercicio de crítica en el que se daba por sentado que la responsabilidad de un editor no se limitaba a garantizar un nivel de ventas. Había también una responsabilidad intelectual de saber por qué se hacía lo que se hacía, cómo y para quién. En la rue Jacob aprendí así a redactar informes, cuartas de forro y solapas, comunicados de prensa y hasta documentos comerciales; pero sobre todo a Seuil le debo una idea de lo que significa editar.

croixdusud

Un ejemplo de La Croix du Sud de Caillois: Sécheresse, de Graciliano Ramos.

Tu entrada como director del ámbito de la lengua española en Gallimard se produce en 1996 para sustituir a Severo Sarduy (1937-1993). Por la fecha en que se produce esa llegada de Sarduy, probablemente por problemas de salud ya no tendría ocasión de desarrollar grandes proyectos, pero aun así crea la Nouvelle Croix du Sud (1991-1995), que venía a revitalizar la Croix du Sud (1952-1970) iniciada por Roger Callois (1913-1978) a su regreso de Argentina.

A fines de los ochenta, Sarduy estaba ya muy enfermo y le era muy difícil llevar adelante el proyecto. Su idea era sin embargo original: la Nueva Cruz del Sur debía ser como una meta-colección que releyera críticamente, a veinte años de intervalo, la colección de Caillois. Por un lado, Sarduy pretendía poner en tela de juicio el aspecto pedagógico del latinoamericanismo de Caillois (habría que recordar que la colección de Caillois publicaba a la vez ensayos culturales sobre América Latina y novelas que debían ilustrar las realidades del continente); por otro, Sarduy aspiraba a ampliar y a actualizar la percepción que se podía tener de la literatura latinoamericana en Francia en aquel momento, editando autores anteriores o posteriores al boom, como Macedonio Fernández y César Aira, como Leopoldo Marechal y Luis Rafael Sánchez.

En 1990, cuando Sarduy deja le Seuil por Gallimard, me pide que ocupe el lugar de lector principal en su nuevo equipo. Así llego a Gallimard. Mi papel fue, en un comienzo, el del lector que debía ir buscando a los nuevos autores, pero la enfermedad de Sarduy hizo que la gestión del proyecto fuera cada vez más difícil dentro del equipo y que la nueva colección no consiguiera afirmarse como una propuesta viable. Cuando en 1993 muere Sarduy, aún quedan algunos títulos por publicar y hay que ocuparse de ellos. Mi intención era editar esos títulos pendientes y luego marcharme a los Estados Unidos, a seguir una carrera universitaria allí. Ese fue el plan hasta que, en 1996, Antoine Gallimard me encargó la gestión editorial de toda el área iberoamericana en la colección Du Monde Entier.

nouvellecroixdusud

Un ejemplo de la Nouvelle Croix du Sud.

Con antecedentes tan ilustres en el cargo, como Valéry Larbaud, Héctor Bianciotti, Caillois o Sarduy, su legado en Gallimard debía de resultar de entrada un poco intimidatorio o imponía un nivel de exigencia bastante alto en cuanto a la literatura americana en español, ¿no? ¿Qué sesgo nuevo pretendías darle o cuál era tu intención respecto de las letras en lengua española en Gallimard?

Digamos que las cosas se fueron haciendo gradualmente, lo que les quitó peso y presión. Además, no eran ya los mismos tiempos ni los mismos públicos, ni tampoco la misma editorial. El fracaso de la Nueva Cruz del Sur me sirvió para entender que ya no se podía seguir defendiendo el principio de una colección latinoamericana al margen de las colecciones generales de literaturas extranjeras, como Du Monde Entier. Había que partir del fondo excepcional de autores iberoamericanos que teníamos (y tenemos) en esa colección y pensar una política destinada a preservarlo, renovarlo y ampliarlo. Preservarlo significaba entonces (y significa ahora) conservar dentro de la casa a los autores principales del catálogo: Borges, Cortázar, Onetti, Cabrera Infante, Paz, Fuentes, Vargas Llosa… Había que seguir publicando sus obras y garantizarles una presencia continua. Esa fue mi primera línea de trabajo.

Luego, estaba (y está) la segunda: la renovación del fondo a través de nuevas traducciones de algunos clásicos, como Rulfo, por ejemplo, o Josep Pla. Se trataba (se trata) de transformar en ventaja lo que es un problema para el editor de literatura extranjera: el envejecimiento acelerado de las traducciones.

En fin, la tercera línea de mi trabajo editorial fue (y es) la ampliación del fondo con la incorporación de dos tipos de autores: los ya altamente consagrados y canónicos, como Ricardo Piglia, Javier Marías o Sergio Pitol, y las figuras más recientes que son objeto de un cierto consenso crítico, como Yuri Herrera, Hernán Ronsino, Rodrigo Blanco Calderón y Samantha Schweblin, para citar solo a los más recientes.

cailloisocampo

Roger Caillois y Silvina Ocampo (1903-1993).

¿La reivindicación que a menudo se hace de España como puente entre la creación latinoamericana y los mercados europeos, que en relación a lo que conocemos como el boom quizá sea menos controvertido, hasta qué punto se corresponde, históricamente, con la realidad o es una exageración? ¿Cómo ha sido, históricamente, la relación entre los escritores en español y los lectores franceses?

La relación con el público francés es una vieja y buena relación, que se ha ido renovando a través de los años. Los autores de lengua española se traducen, se editan y son muy leídos dentro de un cierto sector del mercado que no se puede comparar con el de los autores anglos, claro, pero que está lejos de ser insignificante.

Sobre el papel de España como puente hacia los mercados europeos y la verdadera historia del boom, habría que matizar mucho e investigar más. Creo que se ha exagerado demasiado. El boom fue un fenómeno complejo y global en el que no hubo un solo actor sino varios. Y el protagonismo entre distintas plazas (Buenos Aires, México, La Habana, Barcelona, Paris) fue compartido. Hoy la situación también se hace cada vez más compleja y global, pues ya España no tiene el monopolio de la venta de los derechos de traducción de autores latinoamericanos, ni París es ya la única vitrina de la literatura mundial. Tanto el capital simbólico como el capital económico están más dispersos y la producción de valor, a nivel global, se ha fragmentado y atomizado. Es más difícil llegar a consensos críticos. Mira, si no, las interminables y dispares listas con que la prensa internacional nos castiga cada fin de año en París, Barcelona, Buenos Aires, Nueva York, México o Madrid.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

De izquierda a derecha: Castellet, García Márquez, Barral, Vargas Llosa, Félix de Azúa, Salvador Clotas, Cortázar y García Hortelano.

En el caso del boom, se asume a menudo que el espacio clave es Barcelona, y la agencia de Carmen Balcells en particular, para su internacionalización. Pero parece lógico pensar que sin traducciones podría haber quedado circunscrito al ámbito hispanohablante, y no fue el caso. ¿Qué pesa más en esa internacionalización, el hecho de que autores como Cortázar residan en París o la existencia de una larga tradición de relaciones entre Latinoamérica y Francia, quizá peor conocida? ¿Qué papel atribuyes en ello a Carmen Balcells?

Carmen Balcells transformó la venta de derechos de traducción en un negocio global. Su modelo fue el del marchant d’art que se implicaba en la vida y la obra de los artistas que representaba y los acompañaba en su aventura creativa. En este sentido, era una mujer notabilísima, que respetaba a sus autores, los conocía y conocía la literatura cuyos derechos de traducción negociaba. Ahora bien, sin el contexto internacional que trajo consigo la Revolución Cubana, sin la potencia y la experiencia del polo editorial de Buenos Aires (ahí estaban Sudamericana, Losada y tantas otras casas), sin las traducciones de la colección de Roger Caillois (que circulaban por toda Europa y llegaban a los Estados Unidos), sin Carlos Barral y sus premios, y en fin… sin tantos otros factores, como el genio de Cortázar, García Márquez y Vargas Llosa, sin todo esto no habría habido ningún boom. Así que no exageremos tanto, por mucho que queramos a Carmen y que nos guste Barcelona.

castelletvalverdepetitbarralvseix

De izquierda a derecha: Castellet, José M. Valverde, Joan Petit, Barral y Víctor Seix.

Lo que sí habría que subrayar es que Carmen, como la mayoría de las agentes españolas, era ante todo una gran lectora de sus autores, los conocía y conocía perfectamente sus obras, y cuando hablaba con un editor extranjero, sabía de qué le estaba hablando y sabían también con quién estaba hablando. Por encima de todo, era una mujer que conocía y amaba la literatura que se escribe en español en las dos orillas de la lengua. No siempre es el caso hoy, ya que la venta de derechos está a veces en manos de agentes que no leen el español ni saben nada de sus literaturas ni se interesan de veras en nuestros escritores; o solo saben hablar de su potencial comercial.

Posteriormente, enterrado ya Franco, París volvió a ser un núcleo de difusión importante en relación a la promoción de escritores españoles como Muñoz Molina (n. 1956), Julio Llamazares (n. 1955), Juan José Millás (n. 1952), Javier Marías (n. 1952), Luis Landero (n. 1948), etc., ¿no?

Rafael Conte (1935-2009).

Es cierto. Allá por los ochenta, cuando trabajaba en le Seuil, la promoción de la nueva ola española fue una de nuestras prioridades. Rafael Conte, amigo de la casa, hizo mucho por ellos. También José Miguel Ullán. Recuerdo el lanzamiento de las novelas de Eduardo Mendoza, o de los libros de la cuentista Cristina Fernández Cubas en París. Fue un gran momento de la narrativa española en Francia. Y creo que tuvo repercusiones en toda Europa, ciertamente.

 

En el caso de la literatura catalana, lo habitual es ampliar los lectores mediante la traducción primero al español, pero no fue ese el caso de Joan Sales y su Incerta glòria, cuya primera traducción fue la de Bernard Lesfargues al francés como Gloire incertaine en 1962 (la española, de Carlos Pujol, tuvo que esperar hasta 1969), pero que gracias a que apareció en una editorial como Gallimard luego fue contratada enseguida en otros países. Hay una vocación explícita, parece, de actuar desde Gallimard como puente entre culturas a través de las traducciones, ¿no es así?

Pascale Casanova habla en su libro La République Mondiale des Lettres (1998) del «efecto París», para referirse al impacto simbólico que supone, a un nivel internacional, la traducción al francés de un autor extranjero. No sé si todavía París tiene esa potestad, pero tradicionalmente las traducciones que publica Gallimard sí han tenido ese efecto canónico, un suplemento evaluativo reconocido por premios internacionales como el Nobel. La correspondencia de Caillois con muchos editores extranjeros constituye un registro de este modo de circulación de las traducciones francesas y de la atención que se les prestaba, que aún se les presta, a nivel internacional.

En la misma colección donde Gallimard sitúa, por ejemplo, las obras de Sándor Márai, Pasternak, Faulkner o Kundera, Du Monde Entier, puede encontrarse el Cahier gris de Josep Pla, Frémisante mémoire de Jesús Moncada, La place du Diamant, de Mercè Rodoreda. Y el tándem Ramón Chao-Serge Mestre ha traducido directamente del gallego varias obras de Manuel Rivas en diversas colecciones de Gallimard, que al parecer han sido en general bien acogidas. ¿Estas obras en otras lenguas peninsulares, llegan a Gallimard a través de traducciones previas al español, o hay una mirada puesta en el canon y las novedades de las literaturas gallega y catalana?

salesgallimard1962Sí se les ha dado una atención especial a las lenguas de la Península. Manuel Rivas se traduce en Gallimard directamente del gallego, como Moncada y Pla del catalán. Desde 1996 he tratado de tener siempre en mi equipo lectores de las diversas lenguas peninsulares y también de portugués, por supuesto. Rivas y Pla, entre otros, han sido acogidos con bastante éxito. De hecho, una de las aventuras editoriales más felices de estos últimos años fue la traducción integral del Quadern Gris, que solo se conocía en francés en una versión fragmentaria y muy reducida. Pla faltaba en el catálogo de Gallimard y traerlo fue como cumplir con una deuda pendiente para con un autor tan excepcional y tan francófilo. Sueño con traducir un día sus libros de vagabundeos gastronómicos.

Hay una impresión bastante generalizada de que en Francia hay un mayor reconocimiento hacia la labor del traductor, ¿responde eso a la realidad y, en tal caso, a qué lo atribuyes? Podría sorprender que en las traducciones francesas suele indicarse en los créditos si la traducción es del español de Chile, de Argentina, de Colombia o de México, ¿cómo encaja eso con la pretendida unidad de la lengua española?

Los traductores franceses han sostenido durante muchos años un largo combate para que se reconozcan sus derechos. Hoy se les tiende a considerar cada vez más como re-escritores y por ende como co-creadores de la obra que traducen. De ahí que su nombre aparezca sistemáticamente junto al del autor en las portadillas y los créditos. Me parece más que justo. Necesario.

También era justo y necesario hacerle un lugar a las variaciones del español y a los diversos españoles americanos. Siempre se indica en la portada, cuando se traduce del español, si procede de México, Cuba, Chile, etc. La lingüística reconoce la importancia de estas modalidades más allá o más acá de la unidad de la lengua, que es sobre todo un asunto político, no literario ni editorial ni científico.

josephinefelliermarcellinkristevabartheswahlsarduy

De izquierda a derecha: Josephine Fellier, Julia Kristeva, Roland Barthes, François Wahl y Severo Sarduy en los tiempos de Tel Quel.

En tanto que editor, no estrictamente como lector, ¿qué editor o editores te parece que por su modo de enfocar el trabajo, su talante o su obra te han servido de modelos o has aprendido de ellos?

Son muchos y es difícil no ser desagradecido e injusto. Ya te hablé de Sarduy y de Wahl. A ambos les debo una cierta fidelidad a las estéticas y al pensamiento de vanguardia. También los Gallimard han sido un modelo por la manera como reparten el peso entre el valor literario y las expectativas económicas: «encuentre usted buenos libros y el servicio comercial encontrará la forma de venderlos», me dijo Antoine Gallimard en nuestra primera entrevista.

Tendría que citar asimismo a Jorge Herralde por razones semejantes: en medio del huracán neoliberal, entre los noventa y dos mil, la literatura siguió siendo un valor en el catálogo de Anagrama y hoy se puede leer en él una propuesta de escritura/lectura arriesgada, influyente y sólida. No debería olvidar tampoco a los dos Manolos de Pre-Textos, Borrás y Ramírez, que desde Valencia nos siguen dando lo mejor de la poesía y el pensamiento contemporáneo contra viento y marea. Se me ocurren tantos otros nombres de colegas y amigos tan notables y tan diferentes, como Pilar Reyes y Jaume Vallcorba, como Joan Tarrida y Juan Casamayor; de todos ellos he aprendido algo en distintos momentos de estos años.

canagrama

De izquierda a derecha: Gustavo Guerrero, Lali Gubern y Jorge Herralde en la Feria de Frankfurt 2012.

Entre las generaciones más recientes, habría que citar a editores latinoamericanos como Leonora Djament de Eterna Cadencia, Eduardo Rabasa de Sexto Piso o Matías Rivas de la Diego Portales, que asocian la publicación de ensayos de humanidades, teoría y ciencias sociales, con literatura de la más alta exigencia. De hecho, algunas de las voces claves entre las nuevas generaciones de narradores y ensayistas han salido de esos catálogos. Acaso el factor común que los une es una apuesta por la innovación en pos de otro equilibrio entre las dos caras del oficio editorial – la comercial y la intelectual – después de unos años en que parecía que el afán de rentabilidad y los grandes conglomerados lo iban a devorar todo.

Algunos críticos literarios y profesores muy vinculados al sector editorial evitan ejercer la crítica literaria cuando esta puede entrar en conflicto con autores representados, editados o incluso con amigos, y de ahí que sólo reseñen obras de autores que, en ese plano y también en el académico, les quedan lejos. Tú, en cambio, tanto en la Nouvelle Revue Française como en Cuadernos Hispanoamericanos o Letras Libres siempre te has ocupado de las novedades de la literatura hispanoamericana, que ha sido también tu campo preferente tanto en la universidad como en el sector editorial. ¿Cómo se lleva esa cuádruple vertiente de escritor, editor, profesor y crítico literario? ¿No se producen ciertas tensiones en el momento de enjuiciar la obra de autores próximos en alguno de esos sentidos?

Tienes toda la razón. Claro que se produce una cierta tensión cuando se ocupan tantos lugares a la vez en el campo literario y hasta puede haber cierto conflicto de intereses. Esto me ha llevado a reducir drásticamente la publicación de reseñas y artículos de crítica en los últimos años, muy a mi pesar porque llegué a la edición a través de la crítica literaria y porque esa vocación primera sigue siendo con la que más me identifico y la que me ha dado más satisfacciones.

Además, el tener que leer continuamente todo lo que se está publicando dentro de área hispánica suele darte una visión bastante privilegiada de lo que se está escribiendo en un momento dado. Si no he descartado del todo seguir haciendo crítica, es porque, como te decía, veo al acto de editar como una continuación o prolongación del gesto crítico por otras vías: es una propuesta de escritura/lectura que, como la de una reseña o un artículo, puede ser más o menos acertada y recibir una acogida favorable o desfavorable. Por eso a veces me permito escribir sobre los autores que edito, en revistas españolas o latinoamericanas y aun ocurre que los incluya en algún curso o seminario universitario. Es otra manera de publicar y de compartir una propuesta de escritura/lectura. También me permito escribir sobre autores a los que no edito por una razón u otra, pero cuyas obras me interesan o entusiasman.

grupoeds

De izquierda a derecha: Elizardo Martinez (Ediciones El Callejón), Gustavo Guerrero, Leonora Djament (Eterna Cadencia), Juan Casamayor (Paginas de Espuma), Antonio José Ponte (El Diario de Cuba) y Eduardo Rabasa (Sexto Piso), en marzo de 2016

Fuentes adicionales:

Catherine Fel, «Entretien avec Gustavo Guerrero, responsable du domain hispanophone chez Gallimard», Bureau International de L´Édition Française, marzo de 2009.

Gustavo Guerrero «Vivimos una tendencia a la novelización», entrevista en vídeo en Casa América, 7 de octubre de 2011.

guerreroanagrama

Libro con el que Gustavo Guerrero obtuvo el Premio Anagrama de Ensayo 2008.

Gustavo Guerrero, «La mediación editorial, la traducción y la difusión de las literaturas latinoamericanas en Francia: el proyecto Medet-Lat France. 1950-2000», conferencia en el Seminario Internacional Redes públicas, relaciones editoriales. Hacia una historia cultural de la edición iberoamericana, 22 de noviembre de 2016.

María Pizarro Prada, «4 preguntas a Gustavo Guerrero», en el blog de Iberoamericana/Vervuert, 5 de noviembre de 2012.

Susana Reinoso, «Gallimard y los lectores», publicado en Ñ, y en Función Lenguaje (sin indicación de fecha).

Web sobre la historia de Gallimard, de la colección Du Monde Entier y web de Éditions du Seuil.

 

Carlos Pujol y la movilidad del canon

«Su presencia hizo más humanos a quienes le conocimos –no de todos los sabios podría hacerse este elogio–, y quizás para un humanista esencial no haya misión más alta.»

Carlos Pujol, «En memoria de Joan Petit», La Vanguardia, 21 de septiembre de 1974

Aub1935

Max Aub.

Que el canon literario español del siglo XX no es –afortunadamente– muy estable y fijo es una evidencia. A finales de ese siglo, por ejemplo, se inició un proceso mediante el cual la obra del escritor Max Aub (1903-1972), cuya difusión se vio decisivamente entorpecida por la censura durante todo el franquismo, empezó a ser conocida y, en consecuencia pudo ser reevaluada, y el resultado de ello, en un período relativamente breve, fue que sus obras empezaron a estar disponibles para los lectores españoles, la crítica tanto académica como de actualidad pudo ponderar los valores de esos textos y finalmente empezó incluso a entrar en planes de estudios, con lo que puede decirse que hoy es poco menos que un autor consagrado. La obra de algunos de los muchos escritores exiliados como consecuencia de la guerra civil española y que en sus culturas de acogida tampoco habían entrado en el canon, como Pere Calders, Ramon J. Sender, Francisco Ayala o Rosa Chacel, experimentaron, con mayor o menor éxito, procesos similares una vez enterrado el dictador.

En el caso, notablemente exitoso, de Max Aub, la primera piedra la puso sin duda el traslado en 1985 de la biblioteca, hemeroteca y los riquísimos archivos del escritor a Segorbe, que propició posteriormente la implicación en 1997 de las administraciones públicas en la creación en ese pueblo de la Fundación Max Aub. Paralelamente, otros hitos en este proceso fueron también el congreso celebrado en Valencia en diciembre de 1993 Max Aub y el Laberinto Español, así como las diversas publicaciones que fueron apareciendo en diversas editoriales comerciales (Alba, Calambur, Destino) y que allanaron el camino al inicio de la publicación de las muy voluminosas obras completas de Max Aub y a la traducción de varias de estas obras a diversas lenguas.

carlospujol

Carlos Pujol Jaumandreu.

Al igual que Max Aub, el escritor, traductor y editor barcelonés Carlos Pujol Jaumandreu (1936-2012) nunca llegó a figurar entre los más famosos de su tiempo, en ninguna de sus facetas, pero existen indicios para pensar que eso puede cambiar en un plazo relativamente breve. La donación en marzo de 2016 del archivo personal de Carlos Pujol a la Universitat Internacional de Catalunya (donde Pujol había impartido clases en sus últimos años) dio pie a un doble proceso de catalogación del legado y de difusión de la obra de este polifacético creador literario que, con la profesora de la Facultad de Humanidades Teresa Vallès a la cabeza, dio como primeros frutos la creación de una web, de una cuenta en twiter, la publicación de una de las mejores novelas de Pujol (La sombra del tiempo) y unas jornadas que pusieron de manifiesto no sólo la actualidad de la obra literaria de Carlos Pujol sino también la profunda huella que, como quien no quiere la cosa, dejó en el ambiente editorial español, y muy particularmente en el barcelonés. A medida que el proyecto se desarrolle es de suponer que las cosas irán poniéndose en su sitio.

Junto con reiteradas alusiones a cuán reticente e incluso huidizo se mostraba siempre Carlos Pujol como creador ante los medios de comunicación, en las referidas jornadas se destacaron varios aspectos que prueban la vocación de perennidad de la obra creativa por un lado, y por otro el talento como orientador de lecturas y la agudeza para atribuir los valores pertinentes a los textos que se sometían a su juicio, distinguiendo además con mucha claridad cuándo se trataba de valores estéticos y cuándo de valores comerciales, lo que le permitía ser un crítico literario de referencia y además un editor inestimable en una empresa como Planeta. Su carácter afable, conciliador lo convertían en un hombre idóneo para ocuparse de la secretaría del Premio Planeta, donde además compartió en los primeros años esa labor con quien no se cansaba de reivindicar como su maestro y mentor, Martí de Riquer (1914-2013).

170117-hum-homenatge-carlos-pujol-13

Laureano Bonet.

Del muy influyente Riquer habló también el profesor Laureano Bonet en su intervención, centrada sobre todo en los entresijos de la enciclopedia Larousse en español que puso en marcha Planeta a principios de los sesenta y sobre todo en la creación y desarrollo de la muy célebre Biblioteca Universal Planeta, donde puso de manifiesto la capacidad y el tacto con que Pujol creaba y dirigía los equipos de trabajo a cuyo frente se ponía. Ésta y otras intervenciones pusieron también de relieve el profundo conocimiento de las culturas francesa e inglesa que Pujol tenía, su amplitud de miras, en buena medida procedente de una formación comparatista avant la lettre, consecuencia a su vez de haber cursado Filología Románica.

De su vertiente como creador literario, desdoblado a su vez en la de poeta, el aforista y narrador, se subrayó su concepción de la responsabilidad del trabajo creativo, en el sentido de ofrecer la mejor obra en la medida de las posibilidades del creador, la intención de publicar a toda costa su obra y someterla luego al juicio libre de los lectores, pero cualquiera que lo haya leído un poco sabe que no pondría ningún empeño en promocionarla (del mismo modo que no se esforzaba en promocionarse a sí mismo y que si a lo largo de su carrera recibió codazos de algún arribista, jamás pagó con la misma moneda).

170117-hum-homenatge-carlos-pujol-16-1

Fernando Valls.

La obra, pues, debe defenderse por sí misma, y tal vez no encontrará la mejor acogida entre sus coetáneos, es posible que su aparición coincida con otras de mérito superior o de mayor relumbrón, pero el hecho de haber sido publicada le garantiza –hasta cierto punto– la capacidad para llegar a los lectores que sabrán, en el presente o en el futuro, disfrutarla. Tanto en su vertiente de escritor como en la de editor, Carlos Pujol era un creador que se apartaba de la norma y se distinguía de lo habitual. Quienes en estas jornadas de homenaje se ocuparon de ello o intervinieron en los debates posteriores a las conferencias (Jordi Gracia, Valentí Puig, Andrés Trapiello, Fernando Valls, David Castillo…) coincidieron en señalar que en términos generales ni la prensa periódica ni los ámbitos académicos habían aquilatado hasta ahora el valor de la obra literaria de Pujol, que no ocupaba el lugar que por méritos estéticos se había ganado, del mismo modo que su conocimiento por parte del común de los lectores tampoco era proporcional a su talento. Los mismo podría aplicarse sin apenas correcciones al lugar que ocupa en el ámbito de la historia de la edición, aun cuando su nombre aparezca siempre cuando se analiza la historia del Premio Planeta.

170117-hum-homenatge-carlos-pujol-13-1

Emili Rosales y Dolors Massot.

Ciertamente, el de Carlos Pujol no es un nombre que suelan mencionar habitualmente como modelo los editores más o menos jóvenes pretendidamente independientes que en nuestros días pugnan por ocupar el espacio mediático, y quizás ello, además de al hecho de que desarrollara toda su carrera en una editorial como Planeta, sea en buena parte debido al particular modo en que Pujol ejerció su magisterio: nada de participación en másteres en edición, ni intervenciones estruendosas en encuentros, congresos o simposios de editores, y mucho menos artículos en prensa sobre el métier, libros de memorias ni nada que ni de lejos pueda parecérsele. Y aun así, son legión los editores afortunados que sacaron provecho de sus enjundiosas conversaciones cara a cara, además de intentar aprender de su ejemplo.

En ciertos aspectos, el caso de Carlos Pujol guarda algunos parecidos, con el de otro editor silencioso y modesto de referencia, Paco Porrúa, quien pese a dar nombre a la sala de actos de una conocida librería de Barcelona, no goza del reconocimiento de otros editores de relumbrón y no siempre de méritos equiparables.

170117-hum-homenatge-carlos-pujol-16

De izquierda a derecha: Manuel Borrás (Pre-Textos), Miguel Ángel del Arco (Comares) y José Ángel Zapatero (Menoscuarto).

Programa de las jornadas de homenaje Carlos Pujol, humanista contemporáneo (Universitat Internacional de Catalunya, 16 y 17 de enero de 2017).

Presentación: Xavier Gil, Marta Lagarriga, Josep Crehueras, Aurora Martínez Ezquerro y Teresa Vallès.

Conferencia: José María Pozuelo Yvancos, «Carlos Pujol, humanista contemporáneo».

Conferencia: Andrés Trapiello, «Carlos Pujol, poeta».

Conferencia: Domingo Ródenas de Moya, «Carlos Pujol, novelista».

Coloquio (moderado por Dolors Massot): Ernesto Ayala Dip y David Castillo, «Carlos Pujol visto por la crítica literaria».

Conferencia: Pere Gimferrer, «Perfil de Carlos Pujol».

Conferencia: Manuel Longares, «Carlos Pujol, aforista».

Conferencia: Andreu Jaume, «Carlos Pujol, traductor».

Conferencia: Valentí Puig, «Carlos Pujol, crítico literario».

Coloquio (moderado por Dolors Massot): Laureano Bonet, Josep Mengual y Emili Rosales, «Carlos Pujol, editor y asesor literario».

Mesa redonda (moderada por Fernando Valls): Manuel Borrás, Miguel Ángel del Arco, Daniel Fernández y José Ángel Zapatero: «Hablan los editores».

Clausura: Teresa Vallès y Carlos Pujol Lagarriga.

la-sombra-del-tiempo-i1n13584271

Edición prologada por Pere Gimferrer y con epílogos del autor y de Teresa Vallès (Fundación José Manuel Lara, 2016).

Fuentes:

Jordi Gracia, «Un raro maestro de la ironía», El País, 22 de enero de 2017.

Carlos Sala, «Carlos Pujol, retrato de un humanista sabio», La Razón, 17 de enero de 2017.

Las fotos del homenaje, cortesía de Teresa Vallès.

La colección Clàssics Moderns y la creación del canon de la literatura universal reciente

En los primeros años de la década de los ochenta del siglo pasado, uno de los cambios que se estaban produciendo en el panorama editorial español era el progresivo crecimiento del público lector en lengua catalana, y, después de un primer momento en que se hubo publicado a los autores importantes en lengua catalana (exiliados y del interior, más o menos canonizados y jóvenes), diversas editoriales dieron respuesta a este crecimiento del número de lectores con estrategias destinadas a poner a disposición de esos lectores unos cánones de la gran literatura universal reciente.

lawrence

Ejemplo de ello es la colección Les Millors Obres de la Literatura Universal (1981-1986), que en el año 1986 se abriría también a obras del siglo XX y que se pudo llevar a cabo gracias en parte a la coincidencia en el tiempo de empresas potentes como Edicions 62 y Enciclopèdia Catalana, que a su vez adquirieron los sellos Proa (que ya antes de la guerra había creado una muy notable pléyade de traducciones de clásicos), La Galera y Pòrtic.

parce

Francesc Parcerisas.

Sólo un poco anterior a la serie Siglo XX de la MOLU es la colección creada en el seno de Edhasa y capitaneada por el entonces joven pero ya laureado poeta y traductor Francesc Parcerisas (n. 1944) Clàssics i Moderns, que en un período muy breve consiguió poner los cimientos de un canon de la literatura universal reciente con un eclecticismo y una amplitud de miras (presencia de literatura fantástica, de novela juvenil, de textos clave de la gran literatura decimonónica, etc.) que hacen que todavía hoy sea difícil ponerle peros a la vigencia del catálogo de Clàssics i Moderns (véase el Apéndice al final). Sobre las intenciones y los modelos escribió un fragmento muy iluminador el propio Parcerisas como apertura a su muy citado artículo «Sobre la traducció catalana d´Una historia de dos ciutats»:

Cuando en el año 1985 empecé a dirigir la colección de traducciones Clàssics Moderns, en la editorial Edhasa, tenía claro que el modelo debía ser un poco ecléctico, para poder publicar en ella autores modernos pero, sobre todo, para poder llenar todas aquellas lagunas de la literatura moderna que los lectores catalanes aún no tenían al alcance. Los modelos de la Biblioteca Popular de L´Avenç, de la Biblioteca Universal, de la Editorial Catalana y de la colección A Tot Vent de Proa eran parte de la historia y del ejemplo, en particular porque la mayoría de colecciones que proliferaron en aquellos años finales del siglo XX estaban mucho más atentas a las novedades y a traducir a los autores contemporáneos que triunfaban en todo el mundo…

Cuando Parcerisas aterrizó en Edhasa, donde desde el primer momento compartió despacho con María Antonia de Miquel (que gestionó algunos derechos que interesaban a Parcerisas), dirigía esa editorial Javier Pérez, pero sin duda el editor de referencia de la casa era el gran Paco Porrúa (descubridor tanto de Cortázar como de García Márquez e introductor en España de la gran novela fantástica y de ciencia ficción moderna), a quien es muy comprensible que le cayera en gracia quien había sido traductor al catalán de El Hòbbit (La Magrana, 1983) y que en esos mismos años traduciría los tres volúmenes de El senyor dels anells (Vicens Vives, 1986-1989).

sranellsvv

A través del jugoso epistolario de Parcerisas con el traductor establecido en Buenos Aires Jordi Arbonés (1929-2001), publicado en Punctum y digno de un comentario más pormenorizado, es posible reconstruir con cierta precisión cómo va creciendo y desarrollándose el catálogo, que se abría con mucha fuerza en los últimos meses de 1985 con tres autores absolutamente indiscutibles y que daban ya medida del rigor y la exigencia estética que guiarían el proyecto: Herman Hesse (Demian, en traducción del poeta Feliu Formosa), Joseph Conrad (La follia d´Almayer, en la traducción del escritor

Antoni López Llausàs.

Antoni López Llausàs.

exiliado en México Josep Carner-Ribalta, que en 1929 había publicado Antoni López Llausàs en la Editorial Catalana) y Virginia Woolf (Orlando, en traducción de Maria Antònia Oliver, quien en 1973 ya había traducido Els anys, para la editorial Nova Terra, y que ese mismo año 1985 obtenía el Premi a la Traducció al Català de la Generalitat de Catalunya). La cuestión no era sólo facilitar el acceso de los lectores catalanes a las grandes obras y autores de los siglos recientes, sino además hacerlo mediante la revisión de las mejores traducciones existentes, caso de haberlas, y sobre todo mediante nuevas traducciones que no estuvieran demasiado apegadas al momento en que se escribían y que, por tanto, pudieran también convertirse en canónicas. Es indudable que los condicionantes de un mercado tan restringido como el catalán influyen en ello, pero resulta asombroso comprobar que la enorme cantidad de esas traducciones encargadas y revisadas por Parcerisas son las mismas que siguen leyéndose más de treinta años después, y lo insólito es que no hayan envejecido más que los originales de los que parten ni delaten el momento en que fueron escritas.

Tras esta tremenda irrupción, Clàssics Moderns empieza a publicar casi un título mensual, de autores además que no estaban libres de derechos, lo que puede dar una cierta medida de las dimensiones de la apuesta que se estaba haciendo por entonces por esta colección. Al margen de una cierta preferencia por la literatura en lengua inglesa (ocho de esos diez títulos) y del hecho de que varios los títulos y autores habían sido ya publicados en español en Sudamericana y Edhasa (Robert Graves, Virginia Woolf, o más adelante Doris Lessing, Graham Greene o Salinger), es notable la coincidencia que sugieren estos títulos en la concepción editorial entre Parcerisas y Porrúa, pues ambos se atreven a situar al lado de clásicos que cuentan con un amplio consenso en las altas esferas académicas (Thomas Mann, Joyce o Hemingway) a otros autores cuya inclusión puede interpretarse –sobre todo en aquellos años– como una reivindicación de su dignidad literaria. Valga como ejemplo el de Ursula K LeGuin (n. 1929), quien en 2016 se convirtió en una de las pocas personas vivas cuya obra ha sido publicada en la célebre colección impulsada por Edmund Wilson (1895-1972) Library of America. Y a ella podrían añadirse los casos de Ray Bradbury (1920-1912; con cuyas Crónicas marcianas había iniciado Porrúa su editorial Minotauro y que al catalán las traduce Quim Monzó), C.S. Lewis(1898-1963; célebre por sus Crónicas de Narnia), el de Isaac Asimov (1919-1992) o el del ya mencionado Tolkien (1892-1973).

tolkiengil-el-pages-de-ham

En octubre de 1986 está fechada una carta de Parcerisas a Arbonès en la que le cuenta que, debido a la avalancha de traducciones que ha recibido, se ve en la necesidad de hacer ciertos reajustes en la programación. Es evidente que el mercado catalán, aun habiendo crecido, no estaba tampoco en aquellos años en condiciones de absorber tal cantidad de gran literatura, y sobre todo en el caso de los autores que todavía no estaban libres de derechos esas contrataciones suponían una inversión que, añadida a las generadas por las traducciones, convenía empezar a amortizar con una cierta celeridad. Por si estas dificultades no bastaran, ese año empezaban a circular los primeros títulos de la MOLU Segle XX, que constituía una dura competencia en un mercado que no daba ya mucho más de sí. Además, gracias a la colaboración de La Caixa, la MOLU podía ofrecer a los traductores unas remuneraciones sensiblemente superiores; tanto es así, que Parcerisas alternó la dirección de Clàssics i Moderns con la traducción para la MOLU de una antologia de Poesia anglesa i nord-americana (1985), y se incluyó también en la MOLU Segle XX la versión que había hecho en 1968 para Edicions 62 de A cadascú el que és seu, de Leonardo Sciascia (1921-1989).

tropiccancer

Sin embargo, ni la cadencia ni la calidad de títulos aparecidos el año siguiente, 1987, se resienten de ello, y es además el momento en que sale a la luz un proyecto largamente deseado tanto por Parcerisas como por Arbonès, la traducción lo más completa posible de la extensa obra narrativa de un autor cuya imagen literaria se había visto sensiblemente distorsionada por sus problemas con la censura, Henry Miller (1891-1980), y a quien ambos consideraban un autor imprescindible en una colección de estas características. Esta operación se abre con El colós del Marussi, con lo cual la pretensión de Arbonès de completar la Trilogía Rosada queda de momento aparcada. Junto a Miller, es notable el empeño de dar a conocer a un escritor con fama de difícil como Nabokov, de quien ese año se publica L´encantador y Lolita, junto  a un surtido de grandes autores que van equilibrando la panorámica de otras literaturas y géneros, pues si bien aparece un Scott Fitzgerald traducido por Neus Arqués, se publican también obras de Dostoyevski, Dylan Thomas o, de nuevo, Herman Hesse.

lolita

En el verano de 1987, Parcerisas hace un primer breve balance de Clàssics i Moderns en una interesante carta a quien sin duda se había convertido en uno de sus traductores más fiables, fieles y comprometidos con la colección:

…tenemos todavía un montón de traducciones paradas y, como siempre, lucho entre encargar aquello que creo importante –y necesario– y que me hace ilusión ver publicado, y aquello que sé que tendrá que pasarse meses en el limbo de los cajones. De todos modos, la colección no va mal y la editorial parece bastante contenta. No es de ningún modo algo espectacular desde el punto de vista económico, pero tampoco deben de perder dinero, cosa que, hoy por hoy, ya es bastante notable.

Lo demostraría por ejemplo, que 1988 es el año en que se publican más títulos (trece), y entre ellos unos Dublineses de Joyce, traducidos por el especialista en tan peliaguda tarea Joaquim Mallafré (n. 1941), la traducción del Retrat de l´artista adolescent, del mismo autor, en la versión que Maria Teresa Vernet (1907-1974) había preparado originalmente para Isard, la colección que dirigía Josep M. Boix Selva en Vergara (1967), la que hizo Estanislau Vidal-Folch (hermano de Ignacio) de Viatge al fons de la nit o la que Helena Valenti (1940-1990) llevó a cabo de El factor humà, de Graham Greene.

maantonia

María Antonia de Miquel.

En 1989 la producción vuelve a descender a ocho títulos (entre ellos A repèl, de Huysmans, traducido por el poeta Miquel Martí Pol, dos de Gerard Durrell y Un niu de tórtores, de Katherine Mansfield), pero 1990 es el año en que aparecen más títulos en Clàssics Moderns, quince, quizás en parte debido a que ese año empieza a ser mayor la presencia de autores libres de derechos (D´Annunzio, Stevenson, dos libros de Baudelaire, otros dos de D.H. Lawrence…), lo cual, del mismo modo que el cambio de encuadernación de tapa dura a rústica con solapas, permitía reducir significativamente costes. No obstante eso, la calidad en la selección de títulos y de las traducciones que van apareciendo a partir de ese momento sigue siendo altísima, aun cuando desde ese otoño Parcerisas empieza a dirigir la colección y a mantener el contacto con los colaboradores desde Londres, por lo que Maria Antònia de Miquel se convierte entonces en un enlace importante en el día a día.

98b8d-joseppalauifabre

Josep Palau i Fabre (1917-2008)

Ese año empieza a tomar cuerpo la idea de reunir la obra principal de Henry Miller, aparece la traducción de Mallafré del Ulises, la de Jordi Sarsanedas de Franny y Zoey de Salinger, la de Xavier Benguerel de Les flors del mal, la de Jordi Ibáñez de L´origen d´una insinuació, de Thomas Bernhard, otros dos títulos de André Gide… Y al siguiente (1991), la traducción y edición de Josep Palau i Fabre de las Iluminacions i Una temporada a l´infern de Rimbaud, un Jacques el fatalista i el seu amo traducido por Joan Tarrida, los Petits poemes en prosa de Baudelaire en versión de Joaquim Sala-Sanahuja… y así hasta un total de once títulos que poco a poco van equilibrando la presencia de literaturas como la francesa y la alemana, pese a mantenerse el predominio de la escrita en lengua inglesa.

Escribe a su privilegiado corresponsal Parcerisas el 30 de octubre de 1991:

Ahora empiezo a estar contento con la colección: tenemos cincuenta títulos a nuestras espaldas y no me arrepiento de haber editado ninguno de ellos. Si acaso, algunos que yo no hubiera publicado son de los que mejor se venden, pero, de entre los que no se venden, no renuncio a ninguno. Hemos conseguido un cierto prestigio y sólo debemos no bajar la guardia: mantener buenos autores, buenas traducciones y buen diseño. El resto son cabòries.

Si, con esto, algún día se cierra el grifo, como mínimo podemos estar orgullosos de la labor llevada a cabo. De momento, Edhasa, con todo, quizá no ganan dinero, con el catalán, pero tampoco creo que lo pierdan.

ulisesEs muy sorprendente, e indicativo de hasta qué punto en Edhasa los directores de colección trabajaban en buena medida a ciegas respecto al rendimiento comercial de los títulos, sin acceso a los números, que sólo tres semanas después Parcerisas informe a Arbonès de que «es inminente una cierta restricción en nuestras traducciones […] tengo una traducción [de Les bostonianes, de Henry James] que duerme sobre mi mesa que ahora no sé si podremos publicar».

Es muy probable que el motivo sea que en esas fechas, aprovechando la Feria de Frankfurt, los propietarios de Edhasa viajaban a Barcelona y era cuando los editores y directores de colección conocían realmente cómo andaban las cosas en este aspecto. Ciertamente, un simple vistazo al apéndice permite advertir hasta qué punto disminuyó la producción en los años siguientes (seis en 1992, tres en 1993, uno sólo en 1994), antes de que la colección fuera adquirida por Enciclopèdia Catalana, y continuada, con otra dirección, en Proa. Pero aun así hubo tiempo de recuperar por ejemplo la traducción de Josep Ros i Artigas (1907-1998) de Torrents de primavera, que se cuenta entre las primeras de una obra de Hemingway (publicada en los Quaderns Literaris de Janes en 1937) que el propio traductor tuvo aún tiempo de revisar, o Un hivern a Mallorca, de George Sand, en traducción de Marta Bes i Oliva, prologada por el poeta y narrador Antoni Marí y completada con un apéndice obra del ilustre mallorquín de adopción Robert Graves (1895-1985).

La situación económica y de gestión desembocó en la sustitución de Javier Pérez por Jordi Nadal, y la severa reducción de las ediciones en catalán que siguieron, la marcha de Paco Porrúa y su Minotauro, las salidas en poco tiempo de María Antonia de Miquel, Raquel Fosalba, Toni Estela, Joan Roig, así como el absorbente trabajo en la Universitat Autònoma de Barcelona fueron motivos más que suficientes para que en la primavera de 1993 Parcerisas acabara por dejar Edhasa, pero, como bien dijo, a la vista del catálogo de Clàssics Moderns, podía estar orgulloso de la labor llevada a cabo.

parce2

Francesc Parcerisas.

Apéndice: Obras publicadas en Clàssics Moderns Edhasa.

Hermann Hesse, Demian, traducción de Feliu Formosa, 1985.

Joseph Conrad, La follia d´Almayer, traducción de Josep Carner-Ribalta, 1985.

Virginia Woolf, Orlando. Una biografia, traducción de Maria Antònia Oliver, 1985.

androides-previewUrsula K. Le Guin, La costa més llunyana, traducción de Madeleine Casas, 1986. (núm 3)

Ray Bradbury, Farenheit 451, traducción de Jaume Subirana, 1986.

Ursula K. Le Guin, Un mag de Terramar, traducción de Madeleine Cases, 1986.

Sylvia Plath, La campana de vidre, traducción de Josep Miquel Sobrer, 1986.

Robert Graves, Jo, Claudi, traducció d´Helena Valentí, 1986.

Hermann Hesse, Siddhartha, una composició india, traducción de Carme Gala, 1986.

Laurie Lee, Sidra amb la Rosie, traducción de Montserrat Solanas, 1986.

Ursula K. Le Guin, Les Tombes d´Atuan, traducción de Madeleine Cases, 1986.

Aubrey Beardsley, Relació de Venus i Tannhauser, prólogo de Joan Perucho, traducción de Corvo & Myer, 1986.

Marguerite Duras, Moderato cantábile, traducción de Joan Cases, 1986.

captenemicHenry Miller, El colós de Marussi, traducción de Jordi Arbonès, 1987.

Ray Bradbury, Les cròniques marcianes, traducción de Quim Monzó, 1987.

Francis Scott Fitzgerald, El diamant gran com el Ritz, traducción de Neus Arqués, 1987. (contes)

Doris Lessing, La terrorista bona, traducción de Ramon Barnils y Francesc Parcerisas, 1987.

Vladimir Nabokov, L´encantador, prólogo del autor, epílogo de Dmitri Nabokov, traducción de Jordi Arbonès, 1987.

Fiodor M. Dostoievski, Dimonis, traducción de Josep M. Güell, 1987.

Hermann Hesse, El llop estepari, traducció de Margarida Sugranyes, 1987.

Vladimir Nabokov, Lolita, traducción de Josep Daurella, 1987.

Dylan Thomas, Sota el bosc lacti, drama per a veus, traducción de Angela Suxton y Salvador Oliva, 1987.

James Joyce, Dublinesos, traducción de Joaquim Mallafrè, 1988.

fillahomerM. Cotzee, Esperant els bàrbars, traducción de Xavier Rello Andreu, 1988.

Roberts Graves, La filla d´Homer, traducción de Isabel Turull, 1988.

Gerard Durrell, Ocells, bèsties i parents, traducción de Josep Julià, 1988.

Mervyn Peake, El Castell de Gormenghast, traducción de Josep Miquel Sobrer, 1988.

Jane Austen, Persuasió, traducción de Jordi Arbonès, 1988.

James Joyce, Retrat de l´artista adolescent, traducción de Maria Teresa Vernet, 1988.

Virginia Woolf, Els anys, traducción de Maria Antonia Oliver, 1988.

Louis-Ferdinand Céline, Viatge al fons de la nit, traducción de Estanislau Vidal-Folch, 1988.

Graham Greene, El factor humà, traducción de Helena Valentí, 1988.

R. R. Tolkien, El Ferrer de Wootton Major; “La Fulla” d´en Niggle, traducción de Jordi Arbonès, 1988.

els-anysMervyn Peake, L´hereu de Gormenghast, traducción de Josep Miquel Sobrer, 1988.

R. R. Tolkien, Gil, el pagès de Ham, traducción de Carlos Llorach, ilustraciones de Pilar Baynes, 1988.

Huymans, A repèl, traducción de Miquel Martí i Pol, 1989.

Graham Greene, El capità i l´enemic, traducción de Xavier Rello Andreu, 1989.

Katherine Mansfield, Un niu de tórtores, Josep Julià, 1989.

Virginia Woolf, Les ones, traducción de Maria Antonia Oliver, 1989.

Thomas Mann, Els caps bescanviats, traducción de Margarida Sugranyes, 1989.

Gerard Durrell, El Jardí dels Déus, traducción de Jordi Arbonès, 1989.

Gerard Durrell, Filets de palaia, traducción de Josep Julià, 1989.

K. Narayan, En Swami i els seus amics, traducción de Ramon Barnils, 1989.

D. Salinger, Franny i Zoey, prólogo y traducción de Jordi Sarsanedas, 1990.

D.H. Lawrence, La Guineu i altres relats, traducción de Josep Julià i Marta Bes, 1990.

Gabriele D´Annunzio, La Leda sense cigne, El company d´ulls sense pestanyes, traducción de Jordi Cornudella, 1990.

Katherine Mansfield, Una mica infantil, traducción de Josep Julià, 1990.

André Gide, L´Immoralista, traducción de Marta Bes i Oliva, 1990.

D.H. Lawrence, Dones enamorades, traducción de Jordi Arbonès, 1990.

Kenneth Grahame, El vent entre els salzes, traducción de Jordi Arbonès, 1990.

Thomas Bernhard, L´origen d´una insinuació, traducción de Jordi Ibáñez, 1990.

Benguerel

Xavier Benguerel.

Charles Baudelaire, Els paradisos artificials, traducción de Carles Castellanos, 1990.

Charles Baudelaire, Les flors del mal, traducción de Xavier Benguerel, 1990.

André Gide, La porta estreta, traducción de Marta Bes i Oliva, 1990.

Roberts Louis Stevenson, Marea minvant, traducción de Judith Willis y Toni Turull, 1990.

James Joyce, Ulises, traducción de Joaquim Mallafrè, 1990.

Henry Miller, Tròpic de Càncer, traducción de Jordi Arbonès, 1990.

Sommerset Maugham, Els Mars del Sud, traducción de Lluis Canyadas, 1990.

Arthur Rimbau, Il·luminacions. Una temporada a l´infern, versión, introducción y notas de Jaume Palau i Fabre, 1991.

S. Lewis, El nebot del mag, traducción de Jordi Arbonès, 1991.

S. Lewis, El lleó, la bruixa i l´armari, traducción de Jordi Arbonès, 1991.

Gerard Durrell, L´excursió i d´altres maremàgnums, traducción de Jordi Arbonès, 1991.

Chales Baudelaire, Petits poemes en prosa, prólogo y traducción de Joaquim Sala-Sanahuja, 1991.

Jane Austen, L´abadia de Northanger, traducción de Jordi Arbonès, 1991.

Denis Diderot, Jacques el fatalista i el seu amo, traducción de Joan Tarrida, 1991.

Horst Bienek, La primera polca, traducción de Carme Gala, 1991.

Charles Dickens, Una historia de dues ciutats, traducción de Jordi Arbonès, 1991.

R. R. Tolkien, Silmaríl·lion, traducción de Dolors Udina, 1991.

Richard Adams, El turó de Watership, traducció de Montserrat Solana i Mata, 1991.

S. Lewis, El cavall i el seu noi, traducción de Jordi Arbonés, 1992.

Fulco di Verdura, Una infancia siciliana. Els dies feliços d´estiu, traducción de Caterina Molina, 1992.

George Sand, Un hivern a Mallorca, prólogo de Antoni Marí, apéndice de Robert Graves, traducción de Marta Bes Oliva, 1992.

Giacomo Joyce, James Joyce, introducción y notas de Richard Ellmann, traducción de Joaquim Mallafrè, 1992.

Isaac Asimov, La segona fundació, traducción de Sílvia Aymerich, 1992.

hemingwayperkins

Hemingway con, a su izquierda, el editor Maxwell Perkins.

Ernst Hemingway, Torrents de primavera, novel·la romantic en honor d´una gran raça en extinció, traducció de Josep Ros-Artigues, 1992.

Ursula K. Le Guin, Tehanu. L´ultim llibre de Terramar, traducción de Madeleine Cases, 1993.

Gerard Durrell, Amb un zoo a les maletes, traducción de Josep Sala Barbany, 1993.

Philip K. Dick, Els androids somien xais electrics. Blade Runner, traducció de Manuel de Seabra, 1993.

R. R. Tolkien, Contes inacabats de Númenor i Terra Mitja, introducción, comentarios, índice y mapas de Christopher Tolkien, 1994.

Fuentes:

Sam Abrams, «Francesc Parcerisas, traductor», Caràcters, núm. 10 (enero de 2000), pp. 7-8.

aarbones-parcerisas-180x276Jordi Arbonès y Francesc Parcerisas, Epistolari, edición al cuidado de Jordi Mas López, Lleida, Punctum (Visions 6), 2016.

Anónimo, «Edhasa reorganiza su plantilla y reduce novedades como reacción a la crisis», El País, 22 de enero de 1993.

Francesc Parcerisas, «Sobre la traducció catalana d´Una historia de dos ciutats», L´Avenç, núm. 411 (abril de 2015), p. 9; recogido en los anejos del epistolario de Parcerisas con Arbonès ya citado, pp. 259-276.

Rosa Maria Piñol, «Edhasa enceta una nova col·lecció de narrativa estrangera en català», La Vanguardia, 24 de diciembre de 1985.

Sobre Jordi Arbonès, véase el portal de la Càtedra Jordi Arbonès, de la Universitat Autònoma de Barcelona.

Y el testimonio oral, que agradezco muchísimo, de Esther López, María Antonia de Miquel y Pablo Somarriba.

Orlando de Rudder (1950-2015) y la «negritud editorial»

orlandoderudderPor la misma naturaleza confidencial de su tarea, no es muy frecuente que los conocidos como «negros editoriales», «escritores fantasmas» o «negros literarios» escriban sus memorias o su autobiografía, pero hay algunas, pocas, excepciones, cuya importancia estriba en mostrar una cara generalmente oculta del campo editorial.

Sin duda el caso más conocido es el del célebre y carísimo Andrew Crofts, autor de unas memorias, Confessions of a Ghostwriter (2014), que venía a añadirse a una bibliografía firmada con su propio nombre con otras atractivos títulos sobre la materia: The Freelance Writer´s Handbook. How to turn your writing skills into a succesful business. How to make money and enjoy your life (2007) y Ghostwriting, publicado por la A&C Black Academic and Professional en 2009. En su web personal pueden verse un listado con algunos de los muchos títulos que ha escrito, tanto de ficción como de no ficción, para que otros los firmaran.

Un poco anterior a estos títulos de Croft es el de la escritora escocesa Jennie Erdal Ghosting, a memoir (Canongate, 2004), donde relata su larga trayectoria como negra editorial al servicio del escritor de origen palestino Naim Attalah, editor y propietario de Quartet Books y de Women´s Press. En 2013 apareció en español en Alba, en traducción de Laura Vidal.

jeanneerdalA diferencia de los títulos mencionados, sí está disponible en español Ècrivain de l´ombre (2006), las memorias de un prolífico e interesante erudito y escritor recientemente fallecido, que en su momento ilusionó a la crítica literaria (sin conseguir en cambio el favor de los lectores), Orlando de Rudder (1950-2015).

Según la escueta información biográfica que ofrece la edición española de este libro, publicado por Trama Editorial:

Nacido en 1950 y doctor en historia de la Edad Media, lleva a cabo una prolífica actividad de creación y desarrollo de talleres de escritura, fundamentalmente dirigidos a los adultos y trabajadores por toda Francia. En 1983 publicó su primera novela, La Nuit des Barnares, y desde entonces ha editado más de 30mobras no sólo literarias, sino también ensayos, diccionarios…

Haciendo un juego de palabras con el clásico de Queneau, el famoso e influyente crítico francés Bernard Pivot saludó esa primera novela de De Rudder –que relata la historia de dos personajes que cruzan Europa de punta a cabo en el año 450 d.C. e incomprensiblemente sigue inédita en español– como un «Zazie en tiempos de Attila». Sin embargo, la propia vida del autor da en sí misma para una jugosa y divertida novela.

pivot

Bernard Pivot.

La abuela de Orlando de Rudder fue la compositora Germaine Tailleferre (1892-1983), única mujer en el Group des Six, que en realidad eran siete: Georges Auric (1899-1983), Louis Durey (1888-1979), Arthur Honegger (1892-1955), Darius Milhaud (1892-1955), Francis Poulenc (1899-1963) y Erik Satie (1866-1925), cuyo mánager era otra celebridad, el escritor y cineasta Jean Cocteau (1889-1963), y su madre (Françoise) nació antes del matrimonio entre Tailleferre y el prestigioso jurista francés Jean Lageat. Orlando es fruto, pues, del matrimonio entre Françoise y el crítico de arte y gastrónomo Jean-Luc de Rudder, uno de los componentes del influyente grupo gastronómico Gault-Millau, que, gracias al crucial apoyo del por entonces editor de Julliard Christian Bourgois (1933-2007), en los años sesenta y setenta del siglo XX promovió y dio a conocer con enorme éxito la nouvelle cuisine en todo el mundo. Por si esos antecedentes fueran poco, según él mismo ha contado, su nacimiento se produjo a bordo de un tren con destino a Roma y, una vez divorciados sus padres, su educación corrió a cargo sobre todo de su famosa abuela materna. A través de ella conoció a la flor y nata de la cultura francesa: Francis Poulenc, Julien Gracq (1910-2007), Boris Vian (1920-1959)… Cuenta sobre ella en Escritor en la sombra: «Fue, con Betsy Jolas, una de las dos músicas francesas más grandes de su tiempo y de otros, sin duda. Mi memoria me habla de ella con dulzura. Se trata de un tono melodioso, melancólico realmente, de una ternura indefinible. Hay que escuchar en sí misma la inflexión de su memoria. Ella aporta muchas otras voces.»

tailleferre

Placa en el número 87 de la rue d´Assas.

Sin embargo, tanta influencia atribuye a su formación musical y como grabador como a la experiencia de gozar de absoluta libertad a los dieciocho años en el París de 1968, adonde llegó tras los pasos de su padre. Transportista de pianos, boxeador, profesor de guitarra y catedrático de historia antigua son algunos de los empleos que desempeñó Orlando antes de que Robert Laffont (1916-2010) le publicara su primera novela ya citada, a la que seguirían una treintena larga de títulos que van desde la erudición histórica hasta el humorismo, pasando sobre todo por las reflexiones sobre la lengua francesa, la biografía y la novela histórica: Lee Jackson (Laffont, 1985), Les carnets de Marianita Pacheco (Regine Deforgues, 1989), Le droit de la blasphème (Renaudot, 1989), insipirado en la persecución fundamentalista a la que fueron sometidos tanto Salman Rushdie como Martin Scorsesse, Une pedagogie du succès (Renaudot, 1989), Le couteau de la Décembre (Presses de la Renaissence, 1989), Aperto libro ou le latin retrouvé (Larousse, 1991), Le traité des traités (J.C. Lattès, 1995), Alfred Nobel, 1833-1896 (Denoël, 1997), Rethorique de la scène de ménage (Hors Texte, 2004)…

Con todo, la carrera literaria de este extraordinario erudito y prolífico escritor aplaudido con entusiasmo por la crítica más exigente parecía tener largas etapas de silencio creativo, sobre los que Escritor en la sombra arroja nueva luz: despojándose del estilo que le hacía fácilmente reconocible para sus lectores, y echando mano de oficio, se dedicaba a escribir para otros, al tiempo que impartía clases de guitarra y de escritura creativa.

cubiertarudder

Quien busque el brillo de las confesiones escandalosas, el desvelo de los clientes famosos que tuvo o las situaciones chocantes a las que tuvo que enfrentarse Orlando de Rudder a lo largo de su carrera es muy probable que se sienta defraudado con este libro, aun cuando relata cómo abandonó la escritura de una serie de novelas escabrosamente pornográficas cuando consideró que se traspasaba una cierta línea de lo aceptable, o incluso aunque haga alguna que otra afirmación un poquito escandalosa:

Se dice que dos o tres de los más conocidos [libros de filoterapia] han sido elaborados por gente que lo ignoran rtodo, que prefieren el whisky a las tisanas. De todas formas, son buenas obras: muy bien documentadas a partir de una bibliografía impresionante y apenas conllevan errores. Sin embargo, el mérito no debe adjudicarse al médico firmante. Ya que, si existe, como mucho se habrá tomado la molestia de echarle una ojeada.

En cambio, quien desee conocer cómo es el oficio en un mercado completamente distinto al estadounidense y las reflexiones que sugiere a uno de sus mejores profesionales encontrará en esta obra una experiencia sumamente enriquecedora.

Al hilo sobre todo de la labor con una mujer que pretende publicar su autobiografía, Orlando de Rudder se plantea en este libro algunas de las principales cuestiones editoriales y literarias, estrictamente literarias, a que se enfrenta un «escritor en la sombra», empezando por su naturaleza y función en el sistema editorial, lo que, tal vez paradójicamente, acaba por dignificar la profesión, porque lo que transluce todo el texto es un profundo respeto por el oficio, por la escritura, y también, consecuentemente, por el lector.

escaner_20161226

Índice.

En opinión de Orlando de Rudder, el «negro editorial» no sólo debe tener oficio, ser un buen conocedor de las técnicas narrativas, del arte de la escritura, de las estrategias para crear personajes (a menudo cuando se trata de construirlos a partir de personajes reales) y los modos de crear determinados ambientes y mantener el interés del lector, sino que para ello es imprescindible que sea un buen lector y que sepa acomodar su estilo a la voz del cliente. En otras palabras, ha de ser capaz de hacer creíble tanto la historia que narra –incluso o sobre todo cuando se trata de una historia verídica– como el estilo del cliente, y de ahí la importancia de haber leído mucho pero leído bien, empapándose de los estilos ajenos y siendo capaz de aprovecharlos en su propio trabajo.

Hace falta un negro que transforme una realidad, lo vivido, en el clon de una ficción engañosa. Para que sea creíble, para que tenga un aire de veracidad…

La literatura no sólo es cruel, sino que también le gusta mostrarse injusta con los que no tienen el talento de vivir episodios extraordinarios, acontecimientos históricos, de forma estética: sucede que nos aburren profundamente. En cambio, otro nos apasionará contando cómo su tía abuela pelaba judías verdes. Cuestión de ritmo, de forma, des estilo.

De Rudder concibe este tipo de autobiografías y memorias destinadas a convertirse en libros «verdaderos» de un cierto éxito casi como un género en sí mismo, con sus pautas y convenciones a las que el escritor puede plegarse en mayor o menor medida, también en función del material y el cliente con el que trabaja, y teniendo en cuenta además que el cliente es en realidad a menudo doble: quien firmará la obra y quien le pondrá el sello de su editorial. Hay, pues, unas reglas a las que debe atenerse, o cuando menos tener en cuenta para satisfacer las expectativas del lector al que se dirige. Y si bien muestra cierta indulgencia hacia la «negritud» en el ámbito académico, y dedica un jugoso capítulo a la «negritud» en las tesis doctorales, se muestra más perplejo ante la «negritud» en las novelas y la poesía:

Igual que puedo comprender que uno haga que cuente su vida un escritor como yo, me cuesta imaginar que alguien pueda hacer que otro le escriba una novela. No comprendo a la gente que actúa así. ¿Por qué no poemas?

Firmar una novela que uno no ha escrito me deja estupefacto. Creo que prefiero la irritante pasividad de los que «querrían escribir» y no llegan a hacerlo. Es en general una por falta de amor recibido o entregado.

escaner_20161226-2

Simpático colofón.

En el sistema editorial francés, mucho más parecido a los hispanos que el estadounidense e incluso el británico, la «negritud» no es sólo un modo de obtener ingresos adicionales para periodistas e incluso traductores, a los que se supone una cierta competencia como narradores, sino que además es una de las principales salidas profesionales de los escritores que pretenden comprar tiempo para poder dedicarlo a textos vocacionalmente literarios.

Extraño oficio, ¿verdad? Se puede redactar una biografía de alguien a quien no se conoce en un mes, hilvanar un manual de saber vivir en quince días, un método de yoga en un mes, esbozar el discurso de un político en menos que canta un gallo. Esto antes de garabatear el libraco de un campeón, o de un actor haciendo guiños sobre su regreso. Y después, por último, quedarse sólo ante sus propias páginas, frente a su obra. Y pasar varias horas para crear cinco líneas, lentamente, en su propio silencio y su celosa soledad. Encontrar la literatura de ofrenda, abandonar la literatura de mercado, deslumbra habitualmente. Se experimenta una especie de vértigo ante la propia libertad. En carne viva.

Y ahí, el oficio no basta…

Orlando de Rudder, Escritor en la sombra, traducción de Miguel Hernández Sola, Madrid, Trama Editorial, 2009.

Fuentes adicionales:

Blog de Orlando de Rudder, aquí.

Biografía de Orlando de Rudder en Babelio.

François Bonneau, «Orlando de Rudder. In memoriam, et que sa joie demeure», L´Irregulier, 28 de octubre de 2015.

Matthias Dormingy, «Orlando de Rudder est décédé», L´Observateur, 22 de octubre de 2015.

Christophe Massé, «Orlando de Rudder», 18 de noviembre de 2018, canalblog.com.

Pascal Perrot,  «Orlando de Rudder, la rage d´écrire», Brouillons de Culture, 28 de noviembre de 2015.

 

 

 

Carlos Barral y Jaime Salinas, caos y orden editorial

El encuentro entre quienes, por motivos muy distintos, se convirtieron en dos de los editores de referencia en la España del siglo XX, Jaime Salinas (1925-2011) y Carlos Barral (1928-1989), se produjo gracias a la intervención de un empresario francés cuya trayectoria se hace difícil de rastrear, Gilbert Garnon. La Histoire des français libres registra un Gilbert Garnon nacido en París el 24 de mayo de 1921 que se pasó a la Francia Libre y se incorporó a la Resistencia francesa en 1943. Por otra parte, la firma de un «Gilbert Garnon» aparece como responsable de unas cuantas ilustraciones pornográficas que acompañan pequeñas ediciones más o menos clandestinas debidas a firmas importantes de la literatura francesa: una Nouvelle Justine del Marqués de Sade prologada por Alain Robbe Grillet (1922-2008), un Gamiani ou deux nuits d´excès, de Alfred de Musset, prologado por la madre del ecofeminismo Françoise d´Eaubonne (1920-2005), Quelques images pour la jeunesse d´Alexandre, con textos de Roger Peyrefitte (1907-2000)…

Menos dudas hay acerca de que el Garnon que, involuntariamente, actuó de puente entre Salinas y Barral es el mismo que en la revista profesional Techniques graphiques publicó SalinasTravesíasdos artículos complementarios en los números 4 (octubre de 1956) y 11 (octubre de 1957) con los títulos respectivos «Implantation des ateliers. Cas d´un atelier travaillant sur édition et revues» e «Implantation des ateliers: L´atelier de façonnage». Y ninguna duda hay de que se trata del mismo Garnon que el 18 de diciembre da en Madrid, bajo los auspicios del Patronato Juan de la Cierva, una conferencia con el título «Cálculo de presupuestos en la industria de Artes Gráficas» y es sin duda el mismo que ya en 1956 se anunciaba en las páginas de Travail et métodes como director de una empresa dedicada a la formación profesional con sede en el número 20 de la parisina rue Delambre. He aquí como lo explica Jaime Salinas en su espléndido libro de memorias Travesías, que abarca desde su nacimiento hasta el momento en que se produjo el feliz encuentro:

Era un joven ingeniero, director de una empresa dedicada a la «racionalización y organización del trabajo», una nueva rama de la ingeniería industrial importada de Estados Unidos readaptada en Francia por un tal Charles Bedaux con el nombre de Système Bedaux. Garnon, como muchos otros, aplicaba el Système Bedaux en la industria de las artes gráficas y de la edición de libros. Ideológicamente estaba muy ligado a ese catolicismo progresista tan lleno de ambigüedades que empezaba a propagarse por Europa y había venido a España con el fin de introducirse en el nuevo mercado. […] Garnon necesitaba un ayudante que dominara el francés, el castellano y el inglés para servirle de enlace en España. […] A mediados de septiembre tenía que presentarme en Bilbao, donde me esperaría Garnon. Empezaría a trabajar el día siguiente.

victorjoanseix

Victor Seix Perarnau i Joan Seix Miralta.

Así pues, Jaime Salinas regresó a España como empleado de Garnon, y su primer trabajo en Bilbao fue para la benemérita empresa Artes Gráficas Grijelmo, por entonces en manos de la tercera generación (Federico Guillermo Grijelmo), impulsora de iniciativas editoriales como Durvan, Neguri, Urmo, Deusto o Prisma. Prosigue Salinas:

En esta imprenta los pocos cajistas que quedaban ya no eran apuestos jovenzuelos, sino hombres encorvados, amargados viejos anarquistas derrotados que se habían salvado del pelotón de fusilamiento. Ahora eran conscientes de que los linotipistas, o Monsieur Garnon con sus reformas, podrían ponerlos en la calle.

Acompañados por los directores, Garnon y yo nos paseamos pomposamente por los talleres. Monsieur Garnon, con su arrogancia gala, ridiculizaba […] los métodos de trabajo, la distribución del material, la calidad de la impresión…

Tras haber emitido un informe proponiendo cambios tendentes a racionalizar los procesos de trabajo y mejorar los controles de calidad, Garnon y Salinas todavía estuvieron un par de semanas en Euzkadi visitando imprentas, pero no lograron cerrar nuevos acuerdos porque, según Salinas, «la verdad era que la mayoría de las imprentas del País Vasco estaban muy al día. Por mar recibían maquinaria inglesa y alemana […] Después de tres días en San Sebastián, el galo se dio por vencido». A continuación se trasladaron en tren a Barcelona, donde tenían una cita en el número 219 de la calle Provenza con Joan Seix Miralta (1903-1993) y su hijo Victor Seix Perarnau (1923-1967). Carlos Barral lo recordaba en sus no muy fiables memorias así:

Salinas apareció por Seix Barral en el otoño, quizá en octubre de 1955, como auxiliar del ingeniero Garnon, especialista en racionalización de empresas de artes gráficas y, a partir de aquella experiencia, creo yo, de editoriales […]. Cuando Victor Seix, su contratador, me lo presentó en el cuarto de los sabios, reparé muy poco en aquel ayudante norteamericano, creí entonces, de apellido español, al que debí tomar por un cronometrador o por alguien de oficio poco simpático. Observé más bien con cierta impaciencia cómo se iba quedando cada vez más tiempo en una mesa solitaria […] Garnon venía poco, Jaime estaba allí casi todo el tiempo conversando discretamente con regentes o con maquinistas o pasando anotaciones folio a folio.

SobrecubiertaBarral

Poco a poco fue estrechándose la relación, y al parecer fue el director literario, Joan Petit (1904-1964), quien cayó en la cuenta de que Jaime no podía ser otro que el hijo del famoso poeta Pedro Salinas. Según cuenta Carme Riera, la presencia de Salinas «influyó notablemente para que Seix Barral se convirtiera, con el apoyo de Petit, en una editorial moderna y, en la medida de lo posible, cosmopolita», y además intentó ejercer, en aras de un mejor funcionamiento de la editorial, una cierta ascendencia sobre el comportamiento personal tanto de Carlos Barral como de Jaime Gil de Biedma (1929-1990), con quien la formación británica que tenían en común facilitaba el entendimiento. Así juzgaba retrospectivamente Barral los primeros pasos de la iniciativa que entonces se disponían a poner en pie:

Hay que tener en cuenta, una vez más, que aquella editorial que unos pocos años más tarde, todavía en una etapa de inmadurez empresarial, había de jugar un papel importante en el rearme de la cultura literaria y humanística españolas, desmanteladas por el franquismo, nacía de la improvisación y en el más absoluto desgobierno financiero. Injertada en una empresa industrial de mediano porte que se movía a impulsos de una inercia indetenible y ritmada, la embrionaria casa editora carecía de cuentas propias, ignoraba la contabilidad de costos y no padecía de estrecheces de los presupuestos de tesorería.

logoseixbarral

Logo de Seix Barral.

El proyecto barraliano nacía, ciertamente, en el seno de una empresa centrada por entonces en la impresión de obras para otras editoriales y en libros destinados a la enseñanza y al público infantil y juvenil, y es Salinas quien con mayor claridad ha contado –a Juan Cruz– en qué condiciones Seix aceptó integrar lo que le parecían veleidades del joven (e inexperto) Barral en el seno de una empresa de sólida trayectoria:

Lo primero que le planteé a Carlos fue cuántos libros quería publicar al año y en qué periodo, plazos de entrega y demás, para lo que me sirvió mi trabajo con el francés. Teníamos que luchar con el viejo Joan Seix, porque los libros que nosotros hacíamos él pretendía imprimirlos cuando las máquinas estaban paradas, ya que entonces el grueso de la facturación de la empresa se hacía con la impresión de calendarios, folletos o libros para otros. Yo consideraba que con ese criterio era imposible que pudiéramos hacer una editorial.

Así pues, parece que, según la versión de Salinas, coincidente en buena medida con las de Carme Riera, originalmente el problema estribaba en la escasa capacidad de organización de Barral, algo en lo que Salinas, por formación y sentido de la responsabilidad, podía ser el contrapeso idóneo. Y a ello hay que añadir la pereza y el desinterés por la novela, de la que se confesaba mal lector. Sin embargo, Barral no lo veía exactamente del mismo modo:

Sin cambiar casi en nada la que había sido hasta entonces su función de consejero externo, [Salinas] adoptó, desde dentro, un papel que los menudos acontecimientos cotidianos y una inercia dinámica que no pudo menos que traer consigo –correctivo al escepticismo de [Joan] Petit y a la escasez de mi voluntad de decisión y combate, sobre todo– hacían cada día más importante. No sé en qué momento, para satisfacción de su vanidad y tranquilidad de su progresiva conciencia profesional, ese papel se tituló oficialmente como el de secretario general, pero esa titulación no tuvo mayor trascendencia y, seguramente, la inventó él mismo.

Parece evidente que no debió de ser fácil intentar poner en orden con Barral manejando el timón. Sin embargo, menos conocida y más asombrosa resulta quizás la influencia de Salinas en aspectos más directamente relacionados con la selección de títulos, sobre todo en cuanto a narrativa y en particular de las fuentes de información, acerca de las que el propio Barral reconoció que:

Por lo que respecta a las fuentes de información, justo es decir que, hasta aquel momento, hasta la llegada de Salinas, las nuestras no habían sido mucho más completas de las que suponíamos a nuestros amigos ultramarinos: unas cuantas revistas literarias francesas, inglesas, italianas, encabezadas por la NRF y por Les Temps Modernes. Y los suplementos de algún semanario centroeuropeo. Desde Salinas las cosas cambiaron y comenzó la era de los viajes frecuentes a París, con cuartel general en el hotel Port Royal, en la esquina de la rue du Bac con la Montalembert, a veinte metros de la Gallimard, y a Milán, donde la información prácticamente universal era más nerviosa y rápida.

marialuzmorales

María Luz Morales.

En su extraordinario diario de su estancia en España tras un muy prolongado exilio, La gallina ciega, Max Aub expone su estupefacción ante el hecho de que alguien de la posición de Carlos Barral le pregunte acerca ya no de ningún escritor cuyas obras no pudieran llegar a distribuirse en la España franquista, sino acerca de la célebre escritora y periodista barcelonesa María Luz Morales (1889-1980), que en los últimos tiempos había llevado además una muy fructífera actividad en el mundo editorial como directora de proyectos en Salvat, creadora de la editorial Surco y con colaboraciones diversas en editoriales de cierto fuste como Juventud y Araluce. Sin embargo, más jugosa todavía es la página de La gallina ciega en que Aub reproduce una conversación entre el escritor y tipógrafo exiliado Bernardo Giner de los Ríos y Carlos Barral –a quien describe como «Señorito y marxista, como hoy se debe ser, sobre todo en Barcelona»– en la que se hace evidente la, por lo menos, imperfecta información de que disponía el editor barcelonés:

Recuerdo a Bernardo contándome una conversación con Carlos:

–Te voy a dar a leer una novela española fenomenal. Tan buena como la mejor de Galdós. Una novela que no has leído nunca.

–¿Cuál? –pregunta intrigado el barbón de treinta años al de cuarenta.

La Regenta.

Bernardo se ríe.

–Si en la escuela, cuando tenía quince años, ya hacía resúmenes…

–¡No es posible!

La España, de Carlos Barral; el México, de Bernardo, que no presume, ni tiene por qué, de grandes escuelas.

–Además está publicada en la colección de Nuestros Clásicos en la Universidad [Nacional Autónoma de México]

Aub1935

Max Aub (1903-1972).

Ciertamente, esa muy imperfecta información de la que disponía Barral puede atribuirse en alguna medida a los tremendos efectos de la censura franquista sobre la divulgación de la obra maestra de Clarín, pero, aun siendo un mal lector de novela, es chocante el desdén con que consideraba la literatura hispanoamericana, y más teniendo en cuenta que  posteriormente ha pasado a la historia como uno de los principales artífices del boom  de la narrativa hispanoamericana e incluso como el adalid de un proyectado puente entre los escritores españoles y los hispanomexicanos (los hijos de los exiliados):

Me sorprendió mucho, cuando conocí a Barral –cuenta Salinas a Juan Cruz–, el enorme desprecio que él tenía por la literatura hispanoamericana; decía que los latinoamericanos eran monos subidos a los cocoteros. Se produjo un incidente con Alejo Carpentier con motivo del Premio Formentor. Las delegaciones enviaban listas de candidatos y de pronto apareció el nombre de Carpentier, que a nosotros no nos decía absolutamente nada. Fue mi amigo [Gudbergur] Bergsson (¡islandés!) quien me dijo que era un autor cubano. Barral cambia por completo de actitud cuando aparecen García Márquez y Vargas Llosa, y se da cuenta de que tiene que tomarse en serio la literatura hispanoamericana.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

Castellet, García Márquez, Barral, Vargas Llosa, Félix de Azúa, Salvador Clotas, Cortázar y Juan García Hortelano en 1972.

En cualquier caso, gracias a su relación con Barral Salinas pudo hacer las primeras armas en la edición, que Carme Riera resume del siguiente modo: La colección de poesía «Colliure fue fundada en 1960 por José M. Castellet, como director, Carlos Barral, que facilitaría gracias a Seix-Barral, la impresión y distribución, Jaime Gil de Biedma y José Agustín Goytisolo, que actuarían de consejeros, y Jaime Salinas, en funciones de editor». Todos aportaron cuatro mil quinientas pesetas, salvo Salinas y Gil, que pusieron seis mil cada uno, de modo que en 1961 pudiera publicarse el primer libro de una colección cuyo éxito Castellet atribuyó significativamente a la buena distribución que consiguió Jaime Salinas.

0c594-homenaje-a-antonio-machado-collioure

De izquierda a derecha, fila superior: Blas de Otero, José Agustín Goytisolo, Ángel González, José Ángel Valente, Alfredo Castellón; fila inferior: Jaime Gil de Biedma, Alfonso Costafreda, Carlos Barral y José Manuel Caballero Bonald.

Salinas tardaría aún un tiempo en convertirse en el editor de éxito económico y cultural a que debe su fama, y, retrospectivamente, juzgaría su etapa al lado de Carlos Barral en términos muy similares a los que pueden hallarse en los testimonios de quienes tradicionalmente han sido considerados sus discípulos:

Me pregunto si no aprendí más acerca de las cosas que no se deben hacer, lo que no quiere decir que olvide mi deuda con él. Lo importante de Carlos era lo que quiso hacer en cierto momento histórico en España, el esfuerzo, el empeño de introducir una literatura extranjera prácticamente desconocida y su afán y entrega admirables sobre todo al principio.

No es escaso mérito lograr introducir algunas muestras de lo mejor de la literatura europea de aquel entonces; pero no otra cosa venían haciendo desde hacia ya algunos años otros editores, como Josep Janés o Luis de Caralt, por ejemplo.

 

ICULT FONS CASTELLET JOSEP M CASTELLET J M VALVERDE JOAN PETIT CARLOS BARRAL Y VICTOR SEIX 1960

En el sentido de las agujas del reloj: Josep M. Castellet, José María Valverde. Joan Petit, Barral y Víctor Seix.

 

Fuentes:

Max Aub, La gallina ciega. Diario español, edición, estudio introductorio y notas de Manuel Aznar Soler, Barcelona, Alba Editorial, 1995.

salinasoficioeditorCarlos Barral, Memorias, edición, introducción y notas de Andreu Jaume, Barcelona, Lumen, 2015.

María Jesús Cava Mesa, «De imprentas e impresores en Bilbao, a comienzos del siglo XX», Bilbao, abril de 2008, p. 15.

Carme Riera, La Escuela de Barcelona. Barral, Gil de Biedma, Goytisolo: el núcleo poético de la generación de los 50, Barcelona, Anagrana (Argumentos 95), 1988.

Jaime Salinas, Travesías. Memorias, 1925-1955, Barcelona, Tusquets, 2003.

Jaime Salinas, El oficio de editor. Una conversación con Juan Cruz (incluye textos de Juan Cruz, Jaime Salinas, Mario Muchnik y Javier Marías), Madrid, Alfaguara, 2013.

 

Novelas, memorias, autobiografías y «negritud editorial»

Del mismo modo que aún hay quien piensa que los niños vienen de París, hay quien da por sentado que el nombre de quien figura en la portada de una novela, una autobiografía o incluso unas memorias es siempre el de quien la puso por escrito. De ser así, la condición de escritor de best sellers iría generalmente asociada a una poco común prolijidad que se hace difícil de compaginar con las intensas giras y compromisos promocionales que esos éxitos comerciales suelen conllevar. Es paradójico que, cuando ganó el muy bien remunerado y por todos conocido como no muy honesto Premio Planeta, el escritor Manuel Vázquez Montalbán (1939-2003) aludiera al deseo de obtener tiempo como su principal incentivo para prestarse a semejante amaño, porque la promoción a la que en esos años (1979) se veían sometidos tanto el ganador como el finalista del galardón planetario suponía más bien la pérdida de mucho tiempo que hubiera podido dedicar a la investigación, la documentación y la escritura.

vazquezmontalban

Manuel Vázquez Montalbán, cuya biografía en español en Wikipedia no refleja que en 1979 ganó el Premio Planeta por Los mares del Sur (curiosamente, en las versiones en catalán e inglés sí se da esa información).

Los editores saben de sobra que determinadas novelas se venden bien casi exclusivamente debido al nombre del autor que figura en su cubierta, y no son pocos de ellos los que en sus primeros años en la profesión intentan explicarse –generalmente sin mucho éxito– por qué algunas buenas novelas de género no se venden ni la mitad de la mitad que otras, a todas luces mediocres, firmadas por nombres reconocibles, que actúan casi como marcas. En la novela de género y en eso que convencionalmente podríamos llamar novela no artística que, sin ser novela de género, todos convendríamos que responde al prototipo de best séller (entendido más como género que como obra de grandes ventas), el hecho de que el nombre de un autor actúe como marca y garantice un cierto nivel de ventas es algo bastante usual. Quizá sea menos habitual en la novela llamémosla «literaria», pero también se da.

James Patterson, Tom Clancy, Stephen King suelen ser sospechosos habituales, pero no parece haber pruebas concluyentes de que ni ellos ni sus editores empleen a otros escritores. Fueron bastante sonadas en cambio las declaraciones que hizo en 2012 el célebre autor de novelas de aventuras y novelas históricas Wilbur Smith (n. 1933) reconociendo que, para satisfacer los deseos de sus fans –y después de firmar un contrato con HarperCollins que le comprometía a publicar seis libros en tres años a cambio de quince millones de libras–, había decidido «cambiar sus métodos de trabajo», lo que en otras palabras significaba servirse de «un selecto equipo de coautores». Otro modo de decirlo hubiera sido contar sin ambages que a partir de entonces se serviría de un equipo de «negros literarios» (o «escritores fantasmas») para, a sus setenta y nueve años, poder cumplir con su contrato: él redactaría un resumen del argumento y la caracterización de los personajes, y otros serían los que pusieran sus ideas por escrito. Alguno de ellos, caso por ejemplo del cantante, modelo y novelista de los mismos géneros Giles Kristian (n. 1975), incluso figuran en las cubiertas de los libros de Wilbur Smith (si bien en caracteres menos vistosos).

wilbursmith

Más conocido incluso es Andrew Crofts, a quien se le atribuye el ser el «negro» mejor pagado, que no tiene inconveniente en que aparezca tal considicón en su entrada en Wikipedia y que incluso ha concedido entrevistas sobre esta materia. Aun así, su fama y reconocimiento difícilmente alcance jamás la del novelista Sinclair Lewis (1885-1951), el primer escritor estadounidense galardonado con el Premio Nobel de Literatura (1930), que tuvo como uno de sus trabajos alimenticios la venta de argumentos, y a él suele atribuirse el de la novela inacabada de Jack London (1876-1916) The Assassination Bureau, a partir de la cual Robert Fisher (1922-2008) escribió un guión que Basil Dearden (1911-1971) convirtió en el film homónimo en 1969. De todos modos, el más reconocido trabajo de Sinclair Lewis como «escritor fantasma» es sin duda el libro que más contribuyó a que el tenis se popularizara en Estados Unidos, Tennis as I Play, que se presentaba como un manual escrito por Maurice E. MacLoughlin (1890-1957) a partir de su experiencia para alcanzar la maestría que en ese deporte había alcanzado este célebre tenista (número uno del mundo en 1914).

sinclairlewis

Sinclair Lewis.

La lista de «negros» célebres no es breve. La cuentista Katherine Anne Porter (1890-1980), que más tarde obtendría un Pulitzer y un National Books Award, tuvo entre sus primeros trabajos al llegar a Nueva York la escritura del libro de memorias My Chinese Marriage, de Mae T. Fraking, cuyos herederos tuvieron la decencia de restituir el nombre de la auténtica creadora cuando hicieron una edición anotada. Este caso, el de la persona formada que recurre a un escritor profesional por limitaciones en el uso del idioma, es también el que propició el trabajo más conocido de Crofts como «negro», las dos novelas autobiográficas de Zana Muhnsen Una promesa a Nadia y Vendidas (publicadas ambas en español por Seix Barral).

H. P. Lovecraft (1890-1937) es el autor del relato presuntamente autobiográfico Under the pyramids, en cuya imagen de portada aparece el nombre de una figura no menos célebre, Harry Houdini (Erik Weisz, 1874-1926); sin embargo, también en su caso más adelante las portadas de la reimpresiones de este texto incorporaron su nombre. El prolífico weirdtalesescritor valenciano Vicente Blasco Ibáñez (1867-1928), al igual que Tomás Luceño (1844-1933), puso su pluma al servicio del grafómano folletinista Manuel Fernández y González (1821-1888), cuya prolijidad en el género de la novela de aventuras de tintes folletinescos le llevó a ser conocido –acaso un poco irónicamente– como «el Alejandro Dumas español», y su obra más bien considerada por la crítica, El pastelero de Madrigal (1862), de la que se vendieron en su momento doscientos mil ejemplares, a menudo se ha atribuido a su «secretario». Según cuenta la leyenda, a menudo Fernández y González se dormía a medio dictar sus novelas, y en lugar de intentar despertarlo o aguardar a que lo hiciera por su cuenta, Blasco Ibáñez avanzaba por su cuenta y riesgo en la escritura sin que a posteriori su jefe se diera cuenta siquiera de lo mucho que había avanzado el trabajo. Y la lista podría continuar casi indefinidamente con nombres de muy distinto rango y pelaje (Scott Westerfeld, Manu Manzano, Paul Auster, Santiago Roncagliolo, Paco Zamora, Larry McMurtry…). Incluso se podría elaborar una bibliografía de novelas en las que esta figura al servicio de la industria editorial se ha convertido en personaje literario (en la que la primera novela de Philip Roth, La visita al Maestro, ocuparía un lugar destacado).

Todo un mundo aparte lo constituyen la inmensa cantidad de novelas que, por muerte del autor antes de llegar a su conclusión, han sido terminadas por escritores a sueldo, y entre ellos encontraríamos a Kingsley Amis (1922-1995) acabando la obra póstuma de Ian Fleming (1908-1964) protagonizada por James Bond, o, más difícil todavía, a escritores como Andrew Neiderman (1940-1986) publicando hasta una cincuentena de presuntas novelas póstumas de V.C. Andrews (1923-1986). ¿Y la prensa y los lectores se lo creían? Lo dudo.

vicenteblascoib

Vicente Blasco Ibáñez

Pese a ser una práctica tan habitual, en el mundo hispánico no está tan ampliamente aceptada y normalizada la figura del novelista a sueldo de un nombre-marca, tal vez por la persistencia de una visión un poco romántica del sistema literario, o tal vez porque, se mire cómo se mire, esa práctica contraviene el espíritu de la mayoría de leyes de la propiedad intelectual inspiradas en la Convención de Berna (por el cual la autoría es irrenunciable). Así, se podría dar incluso el caso que, una vez muerto quien firmó la obra, el autor fantasma reclamara la paternidad del texto, incluso si por contrato –a todas luces nulo– se hubiera comprometido a no hacerlo. El acuerdo entre quien firma la obra y quien la escribe o la encarga (sea un particular o una editorial) no siempre se basa en un forfait (pago inicial único), sino que en ocasiones se reconocen porcentajes en las ganancias (derechos de autor) y la posibilidad de participar en las sumas adicionales que pudiera producir derivaciones como una adaptación cinematográfica. Lo que sí es invariable es la cláusula de confidencialidad, que obliga al negro a no mencionar para quién trabaja o ha trabajado.

Suponer que eso es una práctica circunscrita a los derivados del folletín, a la novela de mala calidad es error frecuente, pues en realidad lo que busca el editor es precisamente preservar unos mínimos cualitativos de la obra, y por tanto buscará los servicios de escritores competentes capaces de copiar el estilo que corresponda. Sin embargo, lo cierto es que el gran mercado para el «negro» es el de las memorias, las autobiografías y, en los últimos tiempos, las celebridades creadas por la televisión, la política o YouTube, allí donde es necesaria la competencia narrativa, un cierto acercamiento al lenguaje de quien firma el texto pero no sujeción a un estilo lingüístico previo. Y, además, sobre todo en el caso de los políticos, es donde las tarifas son más altas. Lo lógico es que, por ejemplo, el seguidor de un determinado músico pretenda conocer de primera mano sus experiencias contadas de un modo claro, bien estructurado y narradas con cierta viveza, y eso es posible que sea más capaz de conseguirlo un buen escriba que el propio músico en cuestión. También es lógico que sea eso lo que prefiera el editor. Lo que ya no es tan lógico es que, cuando se destapa uno de esos casos, los lectores se lleven las manos a la cabeza o se escandalicen. Extraña paradoja, porque, como ya en 2002 escribió muy atinadamente Gregory Baruch en un imprescindible artículo publicado en el Washington Post:

Hay una palabra para describir el hecho de persuadir a alguien mediante engaños para que compre un producto: fraude. Cuando una empresa etiqueta erróneamente la carne de caballo como carne de ternera o las patatas fritas comunes como libres de grasas, por ejemplo, se exponen a ser demandada o acusada de un delito.

Sin embargo, los editores parecen exentos de tal responsabilidad. Actualmente, libros enteros son escritos por personas distintas a las que se nos quieren hacer creer que los escribieron. Sólo que no lo llaman fraude. Lo llaman «escritura fantasma». Y es una práctica común en el mercado literario.

Los editores suelen aducir para justificarse que todo el mundo sabe que los libros supuestamente escritos por celebridades los redactan en realidad ghostwriters, pero entonces, si todo el mundo lo sabe, ¿cuál es el motivo de que a los lectores les sea tan complicado llegar a saber quiénes son sus verdaderos autores.

kingsleyamismartin

Kingsley Amis (izquierda) con su hijo Martin.

Fuentes:

Gregory Baruch, «Artful Decption: If Ghostwriters are Indispensable, Why are They so Invisible?», The Washington Post, 31 de marzo de 2002.

Enrique Campos, «Entrevistamos a un negro literario», Vice, 31 de marzo de 2015.

Enrique Campos, «Andrew Crofts, el escriba mejor pagado del mundo», Esquire, 27 de julio de 2015.

Alejandro Gamero, «Escritores fantasmas y negros literarios», La piedra de Sísifo, 13 de agosto de 2013.

Michael Hafford, «I was a ghostwirter for a ghostwriter», Literary Hub, 1 de diciembre de 2016.

escibalouvreAna Maria Iglesias, «¿Quién es tu negro literario?», Culturamas, 26 de octubre de 2014.

Michel Lafon y Bonoît Peeters, Escribir en colaboración. Historia de dúas de escritores, traducción de César Aira, Rosario, Beatriz Viterbo Editora (Colección Ensayos Críticos), 2006.

Aníbal Malbar, «El “negro” literario” de un político puede cobrar hasta 50.000 euros», El confidencial, 16 de noviembre de 2013.

Winston Manrique Sabogal, «El tabú y la leyenda de los escritores fantasma», El País, 13 de noviembre de 2015.

Ret Marut, «Confesiones de un negro, de un ghostwriter», Yaconic, 26 de agosto de 2016.

Kristin Masters, «Six Famous Authors Who Were Also Ghostwriters», Books Tell You Why, 28 de octubre de 2013.

Neils Sears, «How Wilbur Smith won a £15 million deal….for others to write his blockbusters: Wife number four ‘is behind book-sharing scheme’», Daily Mail, 10 de diciembre de 2012.