El epistolario de un traductor (el de Jordi Arbonès)

Los epistolarios cruzados entre los muy diversos profesionales que intervienen en la edición de los libros constituyen una de las fuentes privilegiadas para conocer cómo eran –incluso más allá de las apariencias– las relaciones entre ellos y muchos pequeños detalles que los documentos procedentes de la prensa e incluso los archivos de las editoriales –caso de conservarse– muy raramente pueden ofrecernos con el mismo grado de precisión. Son, por ejemplo, fuente de primera mano para conocer por qué motivos la aparición de un determinado título se retrasó, cómo se negociaban las tarifas entre editores y traductores, cómo un determinado editor llegó a tener conocimiento de la existencia de una obra que encajaba como un guante en la colección que se disponía a crear… Valgan como buena muestra de ello, por ejemplo, el epistolario entre Gregorio Mayans i Siscar y el barón de Schönberg estudiado por Santiago Axeitos y Antonio Mestre (Universitat de València, 2002), las Cartes completes Joan Sales Mercè Rodoreda, 1960-1983 (Club Editor, 2008) editadas por Montserrat Casals o los recogidos por Ana Gallego Cuñas y Erika Martínez en Queridos todos. El intercambio epistolar entre escritores hispanoamericanos (Bruselas, Peter Lang, 2013), entre muchísimos otros posibles.

El riquísimo y bastante extraordinario caso del epistolario de Jordi Arbonès (1929-2001), que se conserva en la Biblioteca d´Humanitats de la Universitat Autònoma de Barcelona, es otro caso particularmente revelador y útil en este sentido. Afortunadamente, además, el Grup dEstudi de la Traducció Catalana Comtemporània lleva ya unos años editando bastante regularmente en la leridana Punctum los cruces más importantes de Jordi Arbonès, entre los que se cuentan los del escritores, eruditos y editores Manuel de Pedrolo (1918-1990), Albert Manent (1930-2014), Matthew Tree (n. 1958), Joaquim Carbó (n. 1932), Francesc Parcerisas (n. 1944) y, en 2017, Antoni Clapés (n. 1948), que quizá sea de toda la relación precedente el menos conocido pero sin embargo uno de los más necesarios, porque a partir de su epistolario con Arbonès se pueden reconstruir (y Pep Sanz Datzira se ocupa de ello con pormenor, incluyendo un imprescindible anexo) algunas aventuras editoriales comercialmente muy modestas pero culturalmente muy exigentes de las que, de otro modo, quizás apenas tendríamos noticia. Es el caso, sobre todo, de las Edicions dels Dies (1980-1986) y, con el también poeta y editor Victor Sunyol (n. 1955), de Cafè Central (n. 1989), cuyos catálogos albergan en ambos casos nombres bastante impresionantes.

Mientras que Jordi Arbonès, afincado en Argentina, es hoy uno de los traductores a la lengua catalana más reputados del siglo XX y con una obra más que notable también en lengua española, habiéndose especializado en textos dramáticos y en clásicos contemporáneos (Kipling, Henry James, Hemingway, Henry Miller, Lawrence Durrell, Nabokov, Faulkner, Paul Bowles, Doctorow…), tal vez el conocimiento de la obra editorial de Clapés haya quedado más restringida al círculo de connaisseurs, cosa que se explicaría sólo en parte por el carácter mismo de algunas de sus iniciativas.

Su estreno como editor se produjo en Sabadell, escenario de notables vocaciones editoriales, y se inició simultáneamente en diciembre de 1976 con la creación de la librería Els Dies (en lo que hoy es la calle del Sol, 55). Estrenadas con el Diari 1973 de Feliu Formosa (n. 1934), precedido de una nota introductoria de Joan Oliver (Pere Quart, 1899-1986), pero ese arranque fue seguido de una larga pausa que no se retomó hasta 1980, y a partir de ese momento, en palabras de Pep Sanz Datzira:

Las Edicions dels Dies, aun con un catálogo reducidísimo, tienen el mérito de haber dado a la luz obras y traducciones de Vicenç Altaió, Miquel Bauçà, Joan Borrell, Jordi Coca, Feliu Formosa, Joan Fortuny, Albert Ràfols-Casamada, Joaquim Sala-Sanahuja, Imma Sarduc, Serge Sautreau, Víctor Sunyol o Jordi Vintró, además de acoger el primer libro de Clapés y la traducción de Henry Miller [En tombar de la vuitantena] hecha en Argentina. […] todos los números de la colección Plecs, con una tirada regular de mil ejemplares, mantuvieron un diseño muy cuidado y unificado, con la particularidad de emplear tintas de diversos colores para la impresión del texto. Algunos títulos incorporaban colaboraciones de artistas plásticos como Alfons Borrell, Joan Rabascall, Albert Ràfols-Casamada o Antoni Taulé.

Sin embargo, no menos interesante es la segunda iniciativa editorial de Clapés, más ambiciosa aunque continuadora de la filosofía que animó la primera y, según la declaración que figura en su presentación en su web, siguiendo un modelo de «edición de inmediatez, sin intermediarios, en la línea del DIY (Do It Yourself). Con un Mac clásico y una impresora láser por toda estructura, Café Central se adentró en la edición de plaquettes, que se vendían en las lecturas organizadas en bares, simbólicamente, al precio de un café.»  Se indica, además, que desde entonces se han llevado a cabo más de mil actos públicos (recitales, performances, lecturas, presentaciones…), en los sitios más diversos (Salamanca, Madrid, Francia, Argentina, Chile, Estados Unidos…).

Por el camino, además de la incorporación temprana del ya mencionado poeta vinculado a la editorial EumoVictor Sunyol, cuando Clapés llevaba apenas un año bregando con la idea, se han ido incorporando al equipo la traductora Dolors Udina (n. 1955), el poeta Jaume C. Pons Alorda (n. 1984) y, desde Montreal, la poeta Diane Régimbald.

En el impresionante catálogo de la colección de plaquettes del Cafè Central alternan los nombres Jordi Coca, Perejaume, Màrius Serra, Enric Sòria, Agustí Bartra o Matthew Tree con los de Ángel Crespo, Juan Antonio Masoliver Ródenas, Ana Rosetti, José Corredor-Matheos, Enrique Badosa o José Carlos Cataño, así como con los de David Rosenthal, Maria Luisa Spaziani, Ignacio Delogu, Dylan Thomas… y, por supuesto, Jordi Arbonès, con un Henry Miller (1990) cuyos pormenores en todo el proceso de creación y edición puede seguirse al dedillo en este epistolario.

A las plaquettes hay que añadir aún las colecciones Els Ulls de Tirèsies (Biel Mesquida, Gertrude Stein traducida por Sam Abrams, Francesc Parcerisas, Jordi Nopca…) la Black Mountain (Robert Creeley traducido por Udina, Charles Olson por Abrams, Carles Hac Mor, etc.), la Balbec (Adan Kovacsis, Laura Borràs, Selma Ancira, etc.), Poètiques (Daniel Calabrñes, Rosa Alice Branco traducida por Clapés, Rolf Dieter Brinkmann traducido por Ramón Farrés, Mallarmé traducido por Margarida y Rosina Ballester, etc.) o las más breves Cop de Daus, Paisatge involuntari (cuyo único título es el Fora de lloc de Tree), Altazor (con solo la Antología de Jorge Folch, seleccionada y precedida de una introducción de Enrique Badosa) y algunos títulos fuera de colección entre los que se cuenta, por poner solo un ejemplo más, Inger (1994), de Juan-Eduardo Cirlot.

Sin embargo, además de la creación del Premi Jordi Domènech de Traducció de Poesia o los seminarios de traducción de poesía Anna-Tornada (que promueven la traducción entre autores quebequenses y catalanes), es de justicia destacar también la colección Jardins de Samarcanda, iniciada en 1992 en colaboración con Eumo y que constituye, en palabras de nuevo de Sanz Datzira, «una colección esencial en el panorama poético de las últimas décadas […] que consolidó el modo de hacer inicial de Cafè Central.»

Fuentes:

Web de Cafè Central.

Títulos del epistolario de Jordi Arbonès publicados hasta diciembre de 2017 (vale la pena consultar la web de Punctum para actualizar esta información):

Epistolari Jordi Arbonès & Manuel de Pedrolo, edición de M. Elena Carné, Lleida, Punctum (Visions 1), 2011.

Epistolari Jordi Arbonès & Albert Manent, edición de Ramon Farés, Lleida, Punctum (Visions 2), 2011.

Epistolari Jordi Arbonès & Mattehw Tree, edición de Josefina Caball, Lleida, Punctum (Visions 3), 2013.

Epistolari Jordi Arbonès & Joaquim Carbó, edición de Montserrat Bacardí, Lleida, Punctum (Visions 5), 2014.

Epistolari Jordi Arbonès & Francesc Parcesisas, Lleida, Punctum (Visions 6), 2016.

Epistolari Jordi Arbonès & Antoni Clapés, edició de Pep Sanz Datzira, Lleida, Punctum (Visions 9), 2017.

A ellos puede añadirse, además:

Susana Álvarez y Montserrat Bacardí, «Epistolari Jordi Arbonès-Joan Triadú (1964-1967)», Quaderns. Revista de Traducció, 12 (2005), pp. 85-113.

Anuncios

Samarán, una estirpe de impresores y editores

En 1951 alcanzó en España un resonante éxito un libro entre las memorias y el ensayo más o menos histórico de Josep Maria Fontana Tarrats (1911-1984), por entonces diputado en las Cortes franquistas y jefe del Sindicato Nacional del Textil, con el que se daba a conocer también una editorial, Samarán.

Una de las muchísimas reediciones de la obra de Fontana (la de Acervo, de 1977).

Sin embargo, Samarán aparece por lo menos desde principio de siglo como pie de imprenta de los más diversos impresos. Sin indicación de fecha, pero probablemente de la primera década del siglo XX existen algunos títulos de la madrileña Biblioteca Escolar Recreativa (El premio de la virtud, con ilustraciones de F. Alberti, y Cuentos de Fernandillo, con ilustraciones de Méndez Bringa) que se declaran como a cargo de «S[aturnino] Calleja, March y Samarán» y algunos títulos de la Editorial Saturnino Calleja (de la segunda serie Salgari, por ejemplo) aparecen en los años cuarenta impresos por «Samarán y Compañía».

En los años veinte y treinta, esa madrileña Imprenta de Samarán y Compañía aparece como pie editorial de varios carteles taurinos, así como de los más diversos tipos de discursos académicos, del Anuario del observatorio meteorológico de Madrid, o de revistas como la socialista Juventud o Ritmo, revista musical ilustrada. Quizá más interesantes en el ámbito literario sean dos títulos de 1922, Jardines de Francia, una antología en la que figuran poemas de Baudelaire, Francis Jammes, Verlaine, Verhaeren y la Condesa de Noailles entre otros, en traducción de E. González Martínez (y de la que hay una edición previa, de 1918, de Editorial América) y sobre todo el del escritor y editor estadounidense Isaac Goldberg (1887-1938) La literatura hispanoamericana. Estudios críticos, en traducción de Rafael Cansinos Assens (1882-1964) y precedido de unas «Palabras críticas» del poeta y prestigioso crítico literario Enrique Díez-Canedo (18791-944). Unos años después moría Felipe Samarán y Fernández (1883-1929), miembro de la Asociación General del Arte de Imprimir de la UGT desde los dieciséis años, con lo que tomaba el relevo una nueva generación de una estirpe de impresores cuyos límites no están de momento claros.

Félix Ros (1912-1974)

El éxito comercial de Samarán como empresa editora llega en 1951, con Los catalanes en la guerra de España, de Fontana, cuando figura como director de la misma el poeta y traductor catalán Félix Ros (1912-1974), que se había forjado una cierta fama como editor de la mano de Josep Janés i Olivé (1913-1959) en Emporion y con la creación de la Editorial Tartessos, que posteriormente había vendido a José Manuel Lara Hernández (1914-2003).

Podría deducirse que ese resonante éxito, tan enorme como quizás inesperado, animó el ritmo de producción de Samarán, que después de una segunda obra de Fontana, En el Pirineo se vive de pie (1953) y una primera novela firmada por Cargel Blaston (Yo, rey del hampa, 1954), se acreciente de un modo espectacular en los años siguientes y en particular en 1956. De Cargel Blaston, seudónimo Carlos Lestón (1922-2000), publicó Samarán en 1955 Los cuatro mancos, y ese mismo año la novela del prolífico polígrafo catalán Noel Clarasó La ciudad de los hombres buenos. Novela de la vida posible, encuadradas ya en una colección Hipocampo, que será junto con Borní la más importante de la editorial.

Por otra parte, muy probablemente sea muestra de la vinculación de Fontana con Samarán el hecho que en la imprenta de ese mismo nombre se publique Textil Mensual, la revista profesional del Sindicato Nacional Textil. Y probablemente sea en algunas de las ediciones de Samarán donde se publican las primeras ilustraciones de sobrecubierta de quien fuera secretario de Izquierda Republicana y colaborador de la almeriense Lucha, Manuel Prieto Muriana (n. 1931), que en 1947 había salido de prisión y que más adelante se haría célebre con cubiertas para tebeos y para algunas colecciones populares de Rollán, Bruguera y, en el extranjero, para The Black Horse Western, The Lindford Western Library, Alfred Hitchcock’s Library, Bastei Verlag o Il Giallo Mondadori.

Ilustración de sobrecubierta de Prieto Muriana para La esfinge de Maragata.

Entre los traductores que colaboraron con Samarán, uno de los asiduos fue el manresano Joan Francesc Vidal i Jové (1899-1978), que en tiempos de la República había sido secretario general de Orden Público de la Generalitat de Catalunya, y que ha pasado a la historia de la traducción por ser el primero en verter a una lengua peninsular el Ulises de James Joyce (en 196), si bien su mecanoscrito permaneció en el Archivo General de la Administración hasta que el profesor Alberto Lázaro la dio a conocer en 2007.

De 1956 es por ejemplo la edición de Sonia, los otros y yo, de Pierre Daninos, en traducción de Vidal Jové, así como, en la misma colección Hipocampo (en tapa dura y con sobrecubierta ilustrada), el libro de relatos Las aguas de Arbeloa y otras cuestiones, del escritor falangista y por entonces presidente del Patronato del Museo del Prado Rafael Sánchez Mazas (1895-1966), Cita en Berlín, del escritor francés José Van den Esch, Para usted, Fantasía, del periodista y dramaturgo falangista Tomás Borrás (1891-1976), Granados, de Antonio Fernández Cid, una reedición de la exitosa novela La esfinge Maragata, de la célebre novelista entonces recién fallecida Concha Espina (1869-1955), una traducción de Veinticuatro horas en Le Mans, de Jean Albert Gregoire (1899-1922) o, sorprendentemente, la recuperación de La familia de León Roch, de Benito Pérez Galdós (1843-1920).

La dificultad para advertir una línea editorial más o menos clara en este catálogo de Hipocampo construido por Félix Ros tras el éxito inicial de Los catalanes en la guerra de España bien podría hacer pensar que en la creación del mismo influían desde la voluntad de no perder dinero, y eso explicaría la inclusión de novela popular y de obras que ya habían demostrado su potencia comercial, hasta las ganas de quedar bien con personalidades afectas al régimen franquista.

Más allá de esquivar la ficción, tampoco es mucho más firme la línea editorial de la colección Borní o de Samarán en general, donde también en 1956 conviven Van Gogh según Van Gogh, del oscuro doctor F. Gipson-Müller, con La conquista de los polos, de Roger Vergel o, fuera de colección pero con un aspecto muy similar al de los Hipocampo, Los españoles ante el año 2000. Cosmología de España, de nuevo de Fontana e Interpol (La policía internacional), de A.J. Forrest.

Este frenético ritmo de publicación se ralentiza abruptamente ya en 1957, año en que en la colección Borní aparece la traducción de Vidal Jové de Vivir bajo los faraones, del periodista y divulgador de la arqueología como guionista de la BBC Leonard Cottrell (1913-1974), en una edición profusamente ilustrada con fotografías en blanco y negro fuera de texto y dibujos intercalados en el texto. También en Borní y en 1957 aparece Con dinero rueda el mundo, del furibundo antimasón, antisemita y antiglobalización Henry Coston (1910-2001).

Más difícil es aún encontrar títulos de Samarán ediciones en los años posteriores, aunque en 1958 parece que sigue viva la colección Hipocanto, pues en ella aparecen los cuentos Yo, tu, ella, del ya mencionado Tomás Borrás, y a principios de los años sesenta aún aparecen con pie de Samarán Ediciones los dos libros del arquitecto y narrador Román Aldasoro Campoamor, Brumas de un pasado (1961) y Estirpe de raza (1962), y al año siguiente aún aparecería un libro luego repetidamente reeditado, San Sebastián, biografía sentimental de una ciudad, encuadernado en tapa dura, con guardas ilustradas con una fotografía y profusamente ilustrado y con una carta final del dramaturgo Joaquín Calvo Sotelo (1905-1993) como apéndice. Su autor, el también dramaturgo vasco Jesús María de Arozamena (1918-1972), era consejero delegado nacional de la Sociedad General de Autores (de la que llegaría a ser director general) y cronista oficial de San Sebastián.

Curiosamente, y aunque en años posteriores aún aparecerían otros libros en la Imprenta Samarán y Compañía, parece que el declive en la producción coincide con la compra en 1958 por parte de la familia Samarán de un local madrileño que a principios del siglo XXI saltaría a las páginas de la prensa, el de la calle Amparo 103 (en Lavapiés). A la muerte del último propietario de la imprenta, en 1982, el local fue abandonado, hasta que fue okupado y albergó El Laboratorio, un espacio artístico autogestionado que montó un pequeño museo de la imprenta y que se mantuvo en activo hasta que la justicia española obligó a su desalojo.

En cualquier caso, si poco se sabe de Samarán Ediciones, más allá de la etapa en que estuvo a su frente el editor catalán Félix Ros, la estirpe de los impresores Samarán y sus avatares a lo largo del siglo XX siguen estando en muy buena medida en la sombra.

Fuentes:

Enrique Fernández de Córdoba y Calleja, Saturnino Calleja y su editorial. Los cuentos de Calleja y mucho más, Madrid, Ediciones de la Torre, 2006.

Vicente Alberto Serrano, «Félix Ros o las afinidades electivas», La luna de Alcalá, 1 de octubre de 2017.

Edición de género (femenino)

A Mireia Sopena y a Pura Fernández,

a ambas con un guiño.

 

Cuando a finales de 1987 Silvia Lluís Rovira inició su actividad al frente de Circe, en el seno del Grupo Océano pero con capital independizado, lo hizo, significativamente, definiéndose como directora general y editora de la empresa, en lo que cabe interpretar en cierto modo como una asunción de la doble vertiente de lo que en el mundo anglosajón se define como publisher y editor. Es decir, no sólo se ocuparía de llevar el timón de la empresa en cuanto a la gestión, sino que se responsabilizaba también de los títulos que seleccionaría y editaría. En el momento de presentar el proyecto, se anunciaba con tres colecciones (narrativa, ensayo y biografía), y con la intención de publicar entre 3.500 y .4000 ejemplares de cada título.

No era un propósito tan osado como a primera vista pudiera parecer si se tiene en cuenta que contaba con un padre de amplísima experiencia en el mundo editorial que además hay constancia de que le dio buenos consejos. Josep Lluís Monreal (hijo a su vez de un périto industrial y periodista aficionado apasionado la letra impresa) se había fogueado con el legendario editor Josep Janés i Olivé antes de acabar por poner en pie en 1959 la editorial Danae, donde dio muestras de su talento como editor, para posteriormente asumir una función más de empresario con la creación en 1972 de Ediciones Océano, que con el tiempo se transformarían en el Grupo Océano. Por ello sabía muy bien lo que se decía cuando le recomendó a su hija Silvia algo que puede parecer una perollugrada pero no lo eso: «Si quieres publicar un tercer libro, por lo menos de los dos primeros vende uno, porque si no vendes ninguno de los dos primeros, entonces el tercero no lo vas a publicar».

Lo cierto es que Silvia Lluis arrancó ya a lo grande, y en 1988 salía a la palestra con una excelente biografía firmada por Rauda Jamis de Frida Kahlo, que según declaraba la propia editora en 2003 fue uno de sus mayores y más continuados éxitos: «Sirvió para lanzar en la editorial la colección de biografías y la hizo un referente. Es nuestro libro más vendido y también sobre el que recibo más cartas de lectores que, que me explican cómo ha cambiado sus vidas.» Muestra de la implicación personal de la editora en este libro en particular es el azaroso origen de la decisión de publicarlo. En 1985, durante un viaje profesional a México, había quedado fascinada por una visita a la Casa Azul de la pintora y a la vista de lo expuesto surgió en ella el convencimiento que la de Kahlo era una historia que valía la pena divulgar y dar a conocer más ampliamente. Y quizá no sea exagerado vincular la publicación del libro de Jamis con el auge que experimentó en esos años el interés en el ámbito hispánico por la vida y la obra de Frida Kahlo.

La fecha en que arranca el proyecto es además indicativa, por lo menos retrospectivamente, de un interés de los editores españoles por el género biográfico en aquellos años, pues coincide de modo significativo con la creación del que pronto se convirtió en el galardón de referencia en el mundo hispánico dedicado al género, el Comillas de Tusquets Editores.

Los títulos que lo acompañaron al Frida Kahlo de Rauda Jamis, a un ritmo además altísimo, pronto configuraron una idea muy clara de Circe como editorial profundamente comprometida con una mirada femenina del mundo y con una operación de rescate de vidas femeninas poco o mal conocidas, llevada a cabo con tesón pero sin cerrazones excluyentes. Así, se sucedieron biografías dedicadas a la editora Sonia Brownell, obra además de la reputadísima Hillary Spurling, a Coco Chanel, a Patricia Highsmith, a Dora Maar, a Irène Nemirovsky, a Sylvia Plath, a Susan Sontag o a Tamara de Lampicka, pero también a Jackson Pollock, Francis Bacon o a Jaime Gil de Biedma.

La de Dora Maar, aparecida en 2012, tiene la singularidad de ser la primera ocasión en que respondió a un encargo de la propia Silvia Lluís, pues lo más habitual en Circe era que esa búsqueda de biografías respondiera al propósito de rescatar vidas de luchadoras a partir de libros preexistentes en inglés y, en menor medida, en francés, pero en este caso se le propuso a la historiadora y crítica Victoria Combalía. Al año siguiente aparecía la primera biografía de una mujer española, Maruja Mallo (que en 1995 había inspirado una novela de Ana Rodríguez Fischer, Objetos extraviados, significativamente publicada en la Lumen de Esther Tusquets), en esa ocasión obra de la hispanista estadounidense Shirley Mangini, a quien en el lector español conocía bien porque había publicado ya el volumen dedicado a Gil de Biedma en la colección de Júcar Los Poetas (en 1980), Rojos y rebeldes, la cultura de la disidencia durante el franquismo (en Anthorpos, en 1987) y Las modernas de Madrid, las grandes intelectuales españolas de la vanguardia y Recuerdos de la resistencia, la voz de las mujeres de la guerra civil española (ambos en Península, en 2001 y en 2004, respectivamente).

Sin embargo, si bien siempre será recordada por haber puesto en un lugar preeminente la biografía como género, también se cuentan entre los méritos de Circe haber dado a conocer al lector en español a escritoras tan relevantes y significativas como Amélie Nothomb (Higiene del asesino, 1996; Las catilinarias, 1998, y Atentado, 1999) o Siri Hustvedt (Los ojos vendados, 1992; El hechizo de Lili Dahl, en 1996, y En lontananza, 1998), del mismo modo que es poco recordada como la primera y constante editora de Don DeLillo en los años noventa (Los nombres y Mao II, 1992; Ruido de fondo, 1994; Americana, 1999; Submundo, 2000…) o de Emmanuel Carrère (Fuera de juego, en 1989, y Una semana en la nieve, en 1996), o de títulos tan singulares y exitosos como Las siete cajas, de la barcelonesa Dora Sontheimer, Cisnes salvajes, de Jung Chang, o La pasión de ser mujer (2016), de Eugenia Tusquets y Susana Frouchtmann, por donde desfila una pléyade de mujeres muy en sintonía con los intereses de Circe (Hannah Arendt, Emilia Pardo Bazán, Maria Callas, Anaïs Nin, Eleanor Roosevelt o Mercè Rodoreda) y cuyo título quizá defina por sí solo el catálogo de Circe.

Fuentes:

Web de Circe

Iloveherstory, «Entrevista a Silvia Lluís, editora de Circe», 29 de marzo de 2015.

Amaya Prieto, «Viajamos con arte o por amor al arte. Entrevista a Silvia Lluís y Pilar Rubio», Viaje al centro de la noche, Radio Nacional de España, 6 de marzo de 2013.

Redacción, «El Grupo Océano crea la Editorial Circe, para narrativa y ensayo», El País, 2 de febrero de 1988.

Sergio Vila-Sanjuán, Pasando página. Autores y editores en la España democrática, Destino (Imago Mundi 26), 2003.

Cosas sobre Ontañón, Mada Carreño y la editorial Xóchitl

La relativamente breve historia de la editorial Xóchitl (1941-1948) dejó una estela de interesantes libros repartidos en tres colecciones de cuyo conjunto puede inferirse una interesante perspectiva acerca de la integración de los intelectuales republicanos exiliados en México como consecuencia del resultado de la Guerra Civil.

Este empresa creada por Eduardo de Ontañón (1904-1949), Mada Carreño (1914-2000), con la que se había casado durante la guerra (en 1938), y el mexicano Joaquín Ramírez Cabañas (1886-1945) toma su nombre de una palabra náhuatl (cuyo significado es flor) que posteriormente dio lugar a un nombre de persona. Eduardo de Ontañón ya tenía a sus espaldas una asentada carrera como periodista y editor cuando llegó a México, pues como hijo del librero burgalés Jacinto Ontañón (propietario de la librería que llevaba su apellido, además de editor de la revista satírica El Papa-Moscas), estuvo desde muy joven en contacto con la letra impresa. A los trece años ya publicaba Eduardo de Ontañón en la revista de su padre, pero sobre todo una vez concluidos estudios de periodismo su firma es frecuente en periódicos y revistas de la época como El Diario Español, La Voz de Madrid, Crisol, Luz, Estampa o El Sol, si bien sin duda una de las más importantes fue Parábola, entre cuyos colaboradores se contaban César Arconada, José María Alfaro, Francisco Ayala, Juan Chabás, Pedro Garfias, Juan Ramón Jiménez, Federico García Lorca, Concha Méndez, Pedro Salinas…

Mada Carreño, por su parte, de formación autodidacta, se estrenó ya durante la guerra civil como escritora en periódicos vinculados a las Juventudes Socialistas Unificadas como Alerta, y fue sobre todo en México donde forjó su prestigio como escritora tan prolífica como versátil. Y en cuanto al poeta e historiador Ramírez Cabañas, ya en 1918 había publicado un primer poemario, La sombra de los días, al que habían seguido la novela La fruta del cercado ajeno (1921) y los libros de poemas Remanso de silencios (1922) y Esparcimiento (1925), así como el libro de ensayos Estudios históricos (1935), pero además había figurado como editor de la revista Tiempo, con Francisco Gamoneda había fundado la Librería Biblos (que actuaba ocasionalmente como editorial) y luego desarrollaría una importante labor como editor de textos históricos para la editorial Pedro Robredo.

A la derecha, Eduardo de Ontañón.

Xóchitl se estrena con un libro de impacto, potencialidad comercial y además supieron lograr una buena distribución: una biografía de Hernán Cortes escrita por el prestigioso escritor José Vasconcelos (1882-1959) y con obra gráfica del ilustrador y escenógrafo mexicano Julio Prieto (1912-1977), con la que nacía la colección Vidas Mexicanas (que tomaba como modelo las Vidas Españolas e Hispanoamericanas del Siglo XIX de Espasa-Calpe) acerca de cuya distribución explica Mada Donato en sus memorias:

Cuando tuvimos en nuestras manos el Hernán Cortés de Vasconcelos, con una atractiva portada del escenógrafo Julio Prieto y varios grabados en el texto, fui a ver a los libreros y editores más importantes de México, los Porrúa. Eran –y siguen siéndolo– un clan numeroso de tíos y sobrinos, hermanos y cuñados, tres generaciones por lo menos de una familia de procedencia mallorquina, personas de gran probidad y prestigio. […]

Me ofrecieron adquirir al contado cien ejemplares de cada libro. Con eso teníamos suficiente para pagar los gastos del último y emprender la impresión del siguiente. Visité, con igual fortuna, otra rama de los Porrúa, los dueños de la Librería Robredo.

Si bien este título inicial lo había financiado Ramírez Cabañas, a partir de ese momento arrancó una trayectoria que puso en pie otras colecciones, como la Biblioteca Mexicana de Libros Raros y Curiosos, destinados a bibliófilos y por consiguiente en tiradas más cortas, o, inspirada por Mada Carreño, Historias Apasionadas, acerca de la que cuenta que empezaron a «atesorar todo lo que “de apasionado” figura en la literatura clásica, y obtuvimos resultados excelentes», y así publicaron obra de Rousseau, Dostoyevski, Merimée, Conrad, Nerval, Chateaubriand…

Razones personales, nada menos que la separación del matrimonio de los fundadores, acabó con el proyecto demasiado pronto, pero dejaban una treintena de títulos como testimonio, y en cuanto Ontañón regresó a España Mada Carreño liquidó la empresa y saldó las existencias dejando en manos de la Librería Patria las de la colección Vidas Mexicanas y las de Historias Apasionadas en las del editor de origen catalán Francesc Sayrols, conocido en México sobre todo por ser uno de los pioneros del cómic, en 1934, con la revista Paquín, que en esos momentos acababa de desaparecer (en 1947).

Al margen de ocuparse como albacea de la obra de su buena amiga Magda Donato (1898-1966), a partir de ese momento Carreño ya no volvió a intervenir en el mundo editorial y dedicó sus energías a las más diversas disciplinas (la literatura infantil, la interpretación dramática, el periodismo…), y tampoco Ontañón, gravemente enfermo, tuvo ocasión de hacerlo, e incluso la obra con la que llegó a cuestas, Larra, el español desesperado, no llegó a publicarse nunca, del mismo modo que la gran obra editorial de Carreño, la traducción y revisión de textos de la Biblia del nuevo milenio, no vería la luz hasta el año 2000, en la editorial Trillas.

Fuentes:

Manuel Aznar Soler y José Ramón López García, Diccionario biobibliográfico de los escritores, editoriales y revistas del exilio republicano de 1939, Sevilla, Renacimiento (Biblioteca del Exilio), 4 vols., 2016.

Concepción Bados Ciria, «Republicanas exiliadas en México (I) Mada Carreño», Rinconete, 15 de julio de 2007.

Francisco Blanco, «La revista Parábola y la tertulia del ciprés», Burgospedia, 21 de octubre de 2014.

Mada Carreño, Memorias y regodeos, Universidad Nacional Autónoma de México, 1998.

Catálogos editoriales, sentidos y significados

En su imprescindible vademécum El libro y la edición, Lluís Borràs Perelló distingue muy acertadamente el catálogo bibliográfico (propio por ejemplo de las bibliotecas) de los catálogos de libros valiosos, raros y demás, y también de lo que conocemos como catálogo editorial –entre los que a su vez distingue el catálogo general del especializado y del de novedades–, que define como «El soporte donde se resume y muestra la producción  editorial de la empresa, su estilo, su línea, su dinámica (resumida en los membretes de “Novedad” y “Próxima aparición”)».

Lo cierto es que cualquier tipo de catálogo, desde el de una librería al de un legado por defunción o al de una subasta, son siempre herramientas de una enorme utilidad para enriquecer la historia editorial, en particular en lo que se refiere a épocas remotas, si se someten a un riguroso escrutinio y análisis. Basten como ejemplo algunos de los trabajos recogidos en la obra colectiva La publicidad del libro en el mundo hispánico (siglos XVII-XX): Los catálogos de venta de libreros y editores, en el que diversos estudiosos del libro sacan jugo a documentos que en apariencia pudieran resultar insulsos o, casi indudablemente, de lectura un poco fastidiosa. Resulta asombroso a la luz de este tipo de estudios hasta qué punto los catálogos son fuentes de información de enorme utilidad para recrear hábitos de lectura, relaciones y prácticas en el comercio del libro entre la Península y América, preferencias lectoras de los diversos sectores sociales e incluso formas de esquivar la censura eclesiástica, entre otros aspectos interesantes cuando se abordan con paciencia y se dedican horas de rastrear archivos. Por supuesto, no se trata sólo de localizar estos catálogos y contextualizarlos debidamente, sino además de tener, por lo menos, una idea de qué tipo de libros son los que aparecen en esos catálogos.

Sin embargo, cuando decimos coloquialmente que «una editorial es su catálogo», o incluso, en palabras de Jorge Herralde, que «la biografía de un editor es su catálogo», estamos pensando sobre todo en los catálogos editoriales generales; es decir, aquellos que abarcan todas las publicaciones de todas las colecciones de una editorial desde su fundación hasta el momento presente (o el de su desaparición), y, por muy cuidadosamente que se elaboren y por muy exhaustivos que sus redactores pretendan ser, en su lectura siempre echaremos de menos algunos datos. Pero, claro está, los catálogos no se editan pensando en el historiador de la edición, sino en los lectores, libreros y distribuidores.

Perelló detalla algunos de los datos poco menos que imprescindibles que deben aparecer en este tipo de obras: «Los autores, las colecciones, los títulos y las características de los libros, reflejan la calidad y los objetivos de la editorial, y el catálogo es una de sus mejores cartas de presentación». Valga añadir que, por el contexto de la cita, se deduce que la alusión que hace Borràs Perelló a «los autores» se está refiriendo tanto a los escritores como, si es el caso, a los traductores e ilustradores.

Catálogo de Poseidón ilustrado por Fábregas Pujadas.

En una obra del tipo antes descrito, es lógico que debería aparecer todo título publicado, pero sería muy útil saber también cuántas ediciones (y distinguirlas además de las reimpresiones) y de qué tirada fue cada una de ellas, pues ello permitiría calibrar si se trató de un best séller o de un long séller; de hecho, para tales menesteres sería idóneo que figurara el año de cada una de las reimpresiones, pues podrían facilitar advertir un revival de la obra (que puede ser debido tanto a un movimiento en el canon como, por ejemplo, al estreno de una adaptación cinematográfica exitosa). Se han dado casos de, en una tirada de mil ejemplares, publicar la mitad de los ejemplares con una página de créditos indicando que se trata de una segunda edición, y a menudo se emplea el número de ediciones como dato acreditativo del interés o del éxito de un determinado título, cuando en realidad vender cinco mil ejemplares de una primera edición o cinco ediciones de mil ejemplares cada una significa, exactamente, lo mismo, y acaso lo que puede significar una diferencia es el período de tiempo que se ha tardado en vender esos cinco mil ejemplares.

Para poder reconstruir un catálogo, resultan particularmente útiles los catálogos en los que las editoriales recopilan todo lo publicado hasta una determinada fecha, generalmente significativa o demostrativa de una longevidad poco común (porque es bien sabido que en el mundo editorial la tasa de mortalidad infantil es muy alta). En ese tipo de catálogos conmemorativos de aniversarios de una editorial, por ejemplo, es frecuente –y muy probablemente lógico– que aparezcan absolutamente todos los títulos publicados, estén disponibles o no en el momento de publicar el catálogo, pero puede darse el caso de que esos datos puedan llevar a engaño a ojos inexpertos o si se toman sin las precauciones adecuadas.

Catálogo de la libreía The Dolfin Books, de Joan Gili i Serra.

Volvamos a los ejemplos. En el catálogo de una editorial pueden aparecer los primeros libros de un autor, pero es evidente que de ese dato no puede inferirse que publicó en esa editorial desde el principio, sino que cabe la posibilidad de que los reeditara y que quien le diera la primera oportunidad fuera una editorial distinta a la que, a la larga, acabó por reunir toda su obra. Si a esa falsa deducción inicial, se añade la inferencia problemática de que la editorial en cuestión llevó a cabo una política de autor en ese caso concreto, habrá que desbrozar un poco más la línea de argumentación. Intentar reunir la obra previa de un autor en el momento en que se le publica la, pongamos por caso, cuarta o quinta obra, puede responder a muchos motivos. Podría tratarse de una consecuencia del éxito descomunal de esa quinta obra, y reeditar sus textos previos un modo de sacar todo el jugo posible a ese éxito (o al hecho de haber hecho famoso al autor en cuestión); podría ser también un modo de contentar al autor (deseoso de ofrecer una segunda oportunidad a obras que en su momento pasaron más desapercibidas de lo que él considera justo, y de paso un modo de «hacer caja»), y lógicamente podría tratarse también de la manera elegida por un editor de demostrar su compromiso con la obra de ese autor, sus deseos de asociar ese conjunto de textos del escritor al conjunto de textos del editor, en definitiva: a un modo de hacer «política de autor», aunque sea con efecto retardado.

Del mismo modo, a partir de este tipo de catálogos no es fácil determinar durante cuánto tiempo una editorial dispuso de los derechos de traducción de una obra en concreto, si fue renovando el contrato o sólo dispuso de esos derechos durante un tiempo reducido (pero suficiente para que pueda alardear de tenerlo en su catálogo).

Catálogo de la Editorial Cervantes.

En el caso de las editoriales particularmente longevas, ante ese tipo de catálogos generales que pretenden reunir la historia de la casa, a veces se añade el problema de saber quién estaba al mando de la nave cuándo se publicaron determinadas obras. Y, yendo un poco más allá, ya no sólo quién firmaba los contratos (que cabe suponer que al fin y al cabo es quién tomaba la decisión última), sino también quiénes eran los directores literarios, asesores, lectores y/o scouts (lamento no conocer una traducción idónea al español) que sugerían, proponían y alentaban la publicación de las obras.

En definitiva, los catálogos son fuentes de informaciones un poco peligrosas (en según qué manos), y la interpretación de su sentido puede ser más compleja de lo que a primera vista pudiera parecer. Al fin y al cabo, con el término «catálogo» a menudo nos estamos refiriendo a una construcción abstracta que resulta incomprensible o incoherente sin no se contextualiza con cierto detalle.

 Obras citadas:

Lluís Borràs Perelló, El libro y la edición. De las tablillas sumerias a la tableta electrónica, Gijón, Ediciones Trea (Biblioteconomía y Administración Cultural 269), 2015.

Pedro Rueda Ramírez y Lluís Agustí, coords., La publicidad del libro en el mundo hispánico (siglos XVII-XX): Los catálogos de venta de libreros y editores, Barcelona, Calambur (Biblioteca Litterae 34), 2016.

Eliseo Torres, libros en español en Nueva York

Las grandes naves repletas de volúmenes tienen un inexplicable atractivo para los amantes de los libros, sean o no también éstos amantes de la lectura, y eso quizá contribuya a explicar el éxito que tuvo en su momento la novela de Carlos Ruiz Zafón La sombra del viento. Sin embargo, otro texto narrativo más breve, «El cazador de libros», del escritor José María Conget, narra en forma de relato fantástico una historia arraigada en la veracidad histórica: un bibliófilo fetichista comete la indiscreción de comentar a un amigo sevillano uno de sus más fabulosos descubrimientos, el de un enorme almacén que contiene, por lo menos, un millón de libros. Sin duda, este relato entronca con la historia del mítico edificio de ladrillo rojo donde el exiliado gallego Eliseo Torres almacenó algunas de las ediciones y colecciones de revistas del siglo XX más importantes del mundo hispánico, y su posterior venta al librero, sevillano, Abelardo Linares.

José María Conget.

No abundan los datos acerca de la biografía de Eliseo Torres, haciendo quizá bueno el dicho de «qué necesidad tiene uno de biografía cuando tiene libros a su disposición», pero al parecer este gallego llegó exiliado a Estados Unidos en 1940, cuando contaba apenas dieciséis años. Muy pronto canalizó su pasión por los libros en la compra de bibliotecas de particulares (entre ellos las de algunos intelectuales exiliados importantes) y la apertura en Nueva York de comercios de libros, cuyo éxito se basó sobre todo en la distribución a instituciones académicas estadounidenses que preferían recurrir a sus servicios que empantanarse en comerciar directamente con empresas españolas sometidas a los condicionantes de los ministerios franquistas.

A partir de un pequeño negocio de venta de libros en Manhattan, poco a poco fue comprando las minúsculas librerías españolas abiertas en los alrededores de la calle Catorce, abrió locales sucesivamente en el 800 de la calle 156 Oeste y el 1469 de la avenida St. Lawrence, pero el edificio que se hizo más famoso, y que sirvió de punto de partida a Conget, fue el que Torres compró en el Bronx, concretamente en el cruce de la avenida Garrison y la calle Faile, que Orlando Inoa describe del siguiente modo: «Por el lado de la avenida Garrison cada piso tenía en línea horizontal seis ventanas y por el lado de la calle Faile otras dieciséis, lo cual daba una dimensión colosal y vetusta al inmueble». Ese mismo texto señala que, sin ninguna duda, en ese almacén había más libros editados en la República Dominicana de los que tenía la Librería Trinitaria de Santo Domingo (especializada en libro dominicano), y probablemente eso mismo se podría decir de muchos otros países, pues allí fueron a parar las bibliotecas particulares de muchos escritores y profesores de la más diversa procedencia. Aun así, más que la cantidad, lo asombroso es el resultado de cualquier cata que se haya hecho pública acerca de ese impresionante fondo: primeras ediciones de casi todos los autores de la literatura en lengua española del siglo XX, colecciones completas de revistas literarias y culturales hoy apenas localizables, libros de Borges (cómo no) de los que ni siquiera Maria Kodama tenía ejemplares…

No es de extrañar que, no contento con ello, Eliseo Torres emprendiera su propia aventura editorial, materializada en la firma Eliseo Torres & Sons, en la que destaca de un modo muy particular la Torres Library of Literary Studies, iniciada  a principios de la década de 1970 con un libro de uno de los ensayistas luego más habituales en la editorial, el cubano Carlos Ripoll, y sus Escritos desconocidos de Cuba, Puerto Rico Propaganda Revolucionaria, Juicios, Crítica, Estados Unidos, al que siguió como número 2 el de Edenia Guillermo y Juana Amelia Hernández, Novelística española de los sesenta, donde se analizan con cierto pormenor novelas de Martín Santos, Juan Marsé, Miguel Delibes, Luis Goytisolo, Juan Benet y Ana María Matute. A la vista de ello, y de la labor de puente cultural que conformará la colección, parece claro que hubiera encajado perfectamente en ella el libro del profesor Ángel Valbuena Briones (1928-2014) publicado en Eliseo Torres en 1968, Ideas y palabras, un conjunto de ensayos sobre aspectos diversos en la obra de Rubén Darío, Juan Ramón Jiménez, Machado, César Vallejo, García Lorca, Blas de Otero, Rómulo Gallegos, etc. El catálogo creció rápidamente, con títulos como Quevedo y la poesía hispanoamericana del siglo XX: Vallejo, Carrera Andrade, Paz, Neruda, Borges, de Giuseppe Bellini, o Antonio Buero Vallejo. The first fifteen years, de Jocelyn Ruple, ambos de 1971. Ya a finales de los cincuenta, había publicado algunos títulos en inglés sobre cultura hispánica, como por ejemplo Ramón. A Study of Gómez de la Serna and his works (1957), de Rodolfo Cardona.

La broma literaria (1979), de Estelle Irizarry.

A finales de la década de los setenta (o tal vez a principios de la siguiente) recibió la editorial de Eliseo Torres un tremendo empuje por un camino un poco inesperado pero muy consecuente. En 1979, quizá en un intento de poner un pie en el mercado estadounidense de libros en español, Germán Sánchez Ruipérez había comprado por 300.000 dólares la mítica Las Américas, que estaba por entonces formada por una célebre librería y una editorial (Las Americas Publishing Company), cuyo catálogo tenía unos objetivos similares a los de Eliseo Torres & Sons (proveer a las universidades de estudios filológicos y culturales acerca del mundo hispánico). Por aquel entonces el fundador de Las Américas, el italiano Gaetano Massa (19011-2009), había regresado a su país natal y la venta la gestionó el cubano Pedro Yanes, pero Anaya, después de rebautizar la librería como Las Américas-Spanish Book Center, no tardó en cerrar ambos negocios (entre otros motivos, por el aumento de los precios de los alquileres), y en lo que se refiere al nutridísimo fondo de la editorial, éste fue a parar a manos de Eliseo Torres, ávido de hacerse con cualquier negocio libresco en lengua española que se moviera por el país.

Como es bien sabido, porque en su momento se recogió abundantemente en la prensa española, un par de años después de fallecer Eliseo Torres su gigantesco fondo fue a parar a las manos del bibliófilo, librero y editor de Renacimiento Abelardo Linares, tras una poco ortodoxa negociación con la viuda, Ana Torres (enfermera de profesión). El almacén, situado en una zona no siempre segura, en agosto de 2017 seguía en pie

Fuentes:

Fernando González Ariza, «Las Americas, 1940-1970, una editorial hispánica en Nueva York», en Encarnación Castro Páez, Pedro Cervera Corbacho y Ana María Bocanegra Valle, coords., Historias y desafíos de la edición en el mundo hispánico, vol II, 2013, pp. 289-303.

Orlando Inoa, «Un librero llamado Eliseo Torres», buenalectura.wordpress.com,  2 de septiembre de 2009.

Carmen L. Lobo, «Abelardo Linares, librero en Nueva York», Abc Literario, 22 de diciembre de 1994, pp. 16-18.

Daniel Verdú, «El hombre del millón de libros», El País, 12 de agosto de 2010.

Cecilia G. de Guilarte: De reportera de la CNT a autora de novela rosa (y editora frustrada)

Cecilia G. de Guilarte.

La trayectoria biográfica de la polifacética Cecilia G[arcía]. de Guilarte (1915-1989) resulta bastante singular ya por su misma precocidad (tanto literaria como en cuanto a la militancia en las Juventudes Libertarias). Publicó en Barcelona un primer reportaje inspirado en el viaje transoceánico del Plus Ultra con tan solo once años, a los diecisiete vio en las páginas del periódico de la CNT tinerfeña En Marcha una serie de artículos sobre «La lucha de clases en Italia», hasta que finalmente abandonó su empleo en la Papelera Española de Tolosa, donde trabajaba también su padre, para marchar a Madrid. Allí empezó a trabajar en el periódico Ahora y en la prestigiosa  «Revista Gráfica y Literaria de la Actualidad Española y Mundial» Estampa, que contó entre sus colaboradores con nombres tan notables como los de los artistas gráficos Rafael de Penagos, Salvador Bartolozzi y K-Hito (Ricardo García López), los fotógrafos Antonio Calbache, Campúa (José Demaría Vázquez) y Agustí Centelles y los escritores Josefina Carabías, Andrés Caranque de Ríos, Matilde Muñoz o Eduardo de Ontañón.

Paralelamente, inicia una carrera como narradora sirviéndose de esquemas o modelos cercanos a los de la novela sentimental y folletinesca, con un lenguaje directo y claro creando unos argumentos breves, sencillos, mediante los cuales comunicar aspectos del pensamiento anarquista. Estos rasgos encajan perfectamente (quizás incluso los condicionaran) con los de la colección que desde 1925 estaban llevando adelante Federico Urales (Juan Montseny, 1864-1942), Soledad Gustavo (Teresa Mañé, 1865-1939) y Federica Montseny Mañé (1905-1994): La Novela Ideal, entre cuyas peculiaridades no menores respecto de otras colecciones anarquistas de la época estaba el retribuir tanto los textos como las ilustraciones de cubierta. Como resultado de esta ¿coincidencia?, no es raro que en enero de 1935 la novela Locos o vencidos, apareciera, como número 389, en esta colección, y firmado como Cecilia García. Y a esta seguiría en febrero del año siguiente, en las mismas condiciones, Mujeres (número 497) y, como número 13 de la colección La Novela Vasca, por esas mismas fechas aparecen los dos relatos «Rosa del rosal cortada» y «Los claros ojos de Ignacio», donde el componente ideológico y de crítica social es menos acusado, lo cual podría explicar el cambio de colección, pues en 1935 en La Novela Vasca habían aparecido como primeros números el relato semiautobiográfico del polifacético medico Victoriano Juaristi Sagarzazu (1880-1949) Caminos de Navarra, el relato de Antonio Arabolaza El boticario de Ibarrola, así como Ana Mari, de Bernabé Orogorzi, dirigente de Euzko Abertzale Ekintza (Acción Nacionalista Vasca) que poco después pasaría a dirigir el periódico Ereintza.

Germán Bleiberg.

Sin embargo, el gran salto a la fama de Cecilia G. de Guilarte se produce durante la guerra civil española, que la sorprende en Guipúzcoa y se incorpora al grupo anarquista Los Temerarios, al tiempo que empieza a forjarse fama como una de sus más destacadas corresponsales de la contienda a través de las páginas del donostiarra Frente Popular y de El Liberal. Caída Guipúzcoa, viaja a Vizcaya, donde escribe para CNT Norte (órgano oficial del comité regional del Norte), donde coincide por ejemplo con Germán Bleiberg (1915-1990), hasta que esta cabecera es temporalmente clausurada como consecuencia de sus tensiones con el Gobierno Vasco, y Cecilia empieza a escribir para La lucha de clases. En palabras de Karolina Almagia, (sospechosamente parecidas a las de la contracubierta  de Cecilia G. de Guilarte, reporter de la CNT):

Cecilia fue una mujer que no huyó del peligro y permaneció en medio de la batalla de Irun, en las calles de Bilbo durante los trágicos sucesos del 4 de enero de 1937 (cuando, tras un bombardeo que causó varios muertos, la muchedumbre penetró en las cárceles de la ciudad y causó una matanza entre los presos franquistas), en las posiciones del batallón Isaac Puente en Cimadevilla o en la ofensiva del general Mola.

Guilarte, en el centro de la imagen, al fondo, en una trinchera.

Al término de la guerra, la audaz corresponsal pudo pasar a Francia, donde colaboró en el periódico republicano de Bayona Le Sud-Ouest, hasta que finalmente pudo embarcarse con destino a México. Un puesto de redactora-jefe en la revista femenina El Hogar fue una de sus primeras ocupaciones en la capital mexicana (entre 1941 y 1949), pero en aquellos primeros años se dedicó también a la escritura de breves novelas rosas que le publicó en 1942 la editorial Delly, Camino del corazón, El milagro de la vida y Orgullo de casta, y que ella misma definió retrospectivamente como «Novelas para cambiarlas por pan, sentimentalonas y rosas». Declaró acerca de aquel trabajo:

Escribí tres novelas para ellos… Fíjate que les llevé una y me dijeron: «hay que quitarle cien páginas». Yo cogí cien páginas de cualquier sitio y las quité. Es que era una manera de ganar dinero, pero yo no tenía ilusión de dedicarme a la novela rosa…

En su libro Voces del exilio. Mujeres españolas en México, 1939-1950, Pilar Domínguez Prats rescata unas declaraciones acerca de esos primeros años de exilio en las que Guilarte revela la existencia de un proyecto de crear en la inmediata posguerra unan editorial en México en colaboración con quien en 1936 fuera secretario de la Agrupación de Periodistas de Madrid y uno de los pioneros de la radio en Unión Radio, Rafael Torres Endrina (1897-1945), asociados con quien fuera abogado fiscal del Tribunal Supermo y, durante la guerra, del Tribunal Popular de Murcia, José Gomis Soler (1900-1971), que era además un reputado arabista y había colaborado con diversas publicaciones periódicas ya en tiempos de la Segunda República (el semanario Tiempo, Crónica Ilustrada, Humanismo, Clarín, El Telegrama del Rif, El Sol…) y que en 1952 publicaría en la colección Ideas, Letras y Vida, de la Compañía General de Ediciones, una novela reportaje situada en la guerra civil, Cruces sin Cristo.

Del mismo modo que José Bergamín obtuvo financiación del Servicio de Evacuación de Refugiados Españoles (SERE) para poder poner en marcha su selecta editorial Séneca, que no hay duda de que con sus ediciones contribuyó a la dignificación de la cultura republicana española, según contaba Cecilia G. de Guilarte la intención de esta empresa editorial que ella lideraba era obtener una ayuda de 15.000 pesos de la Junta de Auxilio a los Republicanos Españoles (JARE) para dedicarse a:

La edición de una serie de publicaciones semanales (novelas cortas, teatro, episodios históricos, biografías) de precio barato y fácil divulgación y venta… Además, emplearíamos a muchos escritores y periodistas exiliados, a quienes sería posible ayudar encargándoles originales, traducciones…

Guilarte en México.

La idea parece bien orientada, y además coherente con la necesidad de proporcionar fuentes de ingreso a los refugiados republicanos, pero, por falta de financiación, no pudo hacerse realidad. Cecilia de Guilarte prosiguió su carrera como escritora todo terreno, con colaboraciones en radio, como editorialista y creadora del suplemento de cultura de la cadena de periódicos Healy de Sonora, como jefa del Departamento de Extensión Universitaria y directora de la revista Universidad de Sonora, dejando su amplia obra periodística en cabeceras del exilio vasco (Guernika, Euzko-Gogoa, el Boletín del Instituto Americano de Estudios Vascos, Euzko-Deya), así como una obra literaria no condicionada por la necesidad económica, en la que alternan la novela ─Nació en España (Míjares, 1944)─, el teatro ─La trampa (Costa-Amic, 1958)─, el ensayo biográfico ─Sor Juana Inés de la Cruz. Claro en la Selva (Ekin, 1958) y El Padre Hidalgo, libertador (Universidad de Sonora, 1958)─, antes de su regreso definitivo a su Tolosa natal en 1964, con el que se iniciaría una nueva etapa en la que las colaboraciones periodísticas se conjugarían con el éxito literario (Premio Ancla de Oro ese mismo año, mención de honor en el Premio Gabriel Miró del Ayuntamiento de Alicante en 1969, Premio Águilas por Cualquiera que os dé muerte en 1969…) y con la publicación de inéditos que ha proseguido hasta bien entrado el siglo XXI (Los nudos del quipu, por ejemplo, se publicó por primera vez en la Biblioteca del Exilio en 2015).

Se hace difícil pensar, ante una trayectoria semejante, que si se lo hubiera propuesto Cecilia G. de Guilarte no hubiera podido sacar adelante una colección como la que había proyectado y que probablemente hubiera constituido una ayuda para los intelectuales españoles.

Carnet de periodista expedido por Euzko Deya a nombre de Cecilia G. de Guilarte.

Fuentes:

Karolina Almagia, «Cecilia G. de Guilarte, anarquista y corresponsal de guerra», Gara, 30 de marzo de 2008.

Anónimo, «Cecilia G. de Guilarte. Profesora universitaria y reportera anarcosindicalista», CNT Puerto Real (Cádiz), s/f.

Manuel Aznar Soler, «Cecilia G. de Guiliarte», en Manuel Aznar Soler y José Ramón López García, eds., Diccionario biobibliográfico de los escritores, editoriales y revistas del exilio republicano de 1939, Sevilla, Biblioteca del Exilio, 2016, vol. 3, pp. 7-10.

Blanca Gimeno Escudero El discurso femenino en la obra literaria de Cecilia G. Guilarte, tesis doctoral presentada en la Universidad de Valladolid, 2013.

Cary Parker (dirección y edición) y Mónica Jato (guión y producción), Un barco cargado de… memoria, Independent, 2012. Film.

Mónica Jato, Holly Pike y Ana María Izaskun Ruiz García, Un barco cargado de… (blog).

Julen Lezamiz y Ana Urrutia, «Cecilia G. de Guilarte: de corresponsal en la guerra civil a escritora en el exilio», Revista Internacional de Ciencias Humanas 4 (1025), pp. 137-141.

Pilar Rodríguez Prats, Voces del exilio. Mujeres españolas en México, 1939-1950, Madrid, Universidad Complutense, 1994.

Guillermo Tabernilla y Julen Lezamiz, Cecilia G. de Guilarte, reporter de la CNT. Sus crónicas de guerra, Bilbao, Asociación Sancho de Beurko (Monografías de la guerra civil en Euzkadi 5), 2007.

 

Literatura «de quiosco», «revolucionaria», editoriales «de avazada»…

Al igual que la «literatura de cordel» o el «folletín», existen y empleamos habitualmente algunas categorías que –tradicionalmente o por lo menos en su origen– han sido fronterizas entre la descripción de los principales rasgos de los texto, por un lado, y su soporte, su forma de distribución o incluso sus puntos de venta principales por el otro, como es el caso por ejemplo de la literatura de quiosco, que tal vez para generaciones distintas alude a un tipo de novelas, relatos o textos de divulgación sensiblemente distintos (sicalípticas, de literatura juvenil, de relatos del oeste, etc.).

Eduardo Zamacois (Pinar del Río, Cuba, 1893-Buenos Aires, 1971).

En un libro panorámico centrado en la literatura revolucionaria (otro término conflictivo) publicada con destino a este sistema de venta, y titulado como no podía ser de otra manera, La novela revolucionaria de quiosco (1905-1939), Gonzalo Santonja rescató de las tan poco leídas memorias de Eduardo Zamacois (1873-1971) su testimonio acerca de los avatares del que suele considerarse el primer ejemplo de este género, subgénero o categoría literaria, El Cuento Semanal. Previamente, Alfonso Sastre (n. 1926) se refiere en el prólogo a este libro a la «fórmula Zamacois», pero el caso es que en realidad esta tardó en encontrar la financiación y la infraestructura necesaria para poder ponerse en marcha. La visionaria idea de una colección de muy bajos coste, de libros muy breves, ilustrados, de periodicidad semanal y cuyos potenciales lectores, no necesariamente habituales de las librerías, pudieran encontrar en puntos de venta que frecuentaban para otros menesteres fue rechazada sucesivamente por Ramón Sopena (1869-1932), Gregorio Pueyo (1860-1913) y también por el filósofo y periodista de origen cubano José del Perojo (1850-1908), de Mundo Nuevo, antes de que, gracias a la participación como inversor del también periodista Antonio Galiardo (en agradecimiento a su entrada en el periódico La Publicidad, merced a la intervención de Zamacois), pudiera convertirse en realidad esta colección, que se estrenó el primer día del año 1907 con Desencanto, del escritor y pintor Octavio Picón (1852-1923), quien por aquel entonces tenía a sus espaldas ya una formidable obra como narrador de títulos más o menos inequívocos (La hijastra del amor, 1884; La honrada, 1890; Dulce y Sabrosa, 1891; Drama de familia, 1903…).

El contenido del libro de Santonja es fiel al título que figura en la portada de la primera edición –por cierto: no coincidente con el de la cubierta, que a su vez sí coincide con el subtítulo de una edición del año 2000 SIAL Ediciones–, «Notas para la historia de la novela revolucionaria de quiosco en España (1905-1939)», pues en este breve volumen el autor se centra en unos cuantos casos muy significativos de esta «categoría» o «subcategoría» literaria: El Cuento Semanal de Zamacois, La Novela Roja de Fernando Pintado, La Novela Ideal de la familia Montseny, La Novela Política de Prensa Gráfica, La Novela de Hoy de Artemio Precioso (1891-1945) y unos pocos más, así como en algunas iniciativas nacidas anejas a este tipo de ámbitos editoriales, como es el caso en particular de ciertas novelas de autoría colectiva.

La relativa insatisfacción que pudiera tener el lector interesado en esta materia procede precisamente de ese carácter de notas un poco inconexas, valiosas y útiles en sí mismas pero que constituyen una serie de capítulos escasamente engarzados o articulados para dar respuesta a las preguntas implícitas que se derivan de la lectura del libro.

Pero más allá de quedar esa historia de la literatura revolucionaria en una eterna promesa de la que sin embargo han ido llegando aproximaciones parciales (muchas de ellas del propio Santonja, que recupera fragmentos de este texto en otros títulos y artículos suyos, pero también debidas a José Carlos Mainer, José Esteban, Marisa Siguán, Amelina Correa Ramón y Martínez Arnaldos, entre otros), uno de los mayores intereses de este tipo de aproximaciones es, además de ofrecer listados de las obras publicadas (muy útiles en ausencia de catálogos) y de aportar cuantiosa información acerca del funcionamiento de empresas, obras y autores poco y mal conocidos (en ocasiones debido a la proliferación del empleo del anonimato y de seudónimos en esa época y en esos géneros), no limitarse al estudio de los textos, sino también a establecer los vínculos entre una determinada ideología, unos géneros literarios con unos rasgos bastante bien definidos (y deudores de unas tradiciones fácilmente identificables) y unos determinados sistemas de producción y distribución estrechamente relacionados si no deudores de la configuración de las empresas periodísticas, de la reestructuración de la industria papelera y de los avances y crecimiento de los servicios de impresión. En otras palabras, ofrecer una imagen que tienen tanto en cuenta el sistema editorial como el campo literario.

En realidad este breve libro de Santonja, reeditado en 2000 con diferente título, es una pieza más en la explicación del modo en que se concebía el libro en España en las primeras décadas del siglo XX que resulta indispensable para comprender mínimamente la eclosión posterior de las llamadas –probablemente mal llamadas– «editoriales de avanzada (Ediciones Oriente), cuyo objetivo central era la difusión de la literatura y el pensamiento social y revolucionario a finales de los años veinte y en la década de los treinta», en palabras de Martínez Martín, y cuyos protagonistas en muchas ocasiones ya se habían fogueado en labores editoriales o empresariales en estas mismas iniciativas de los primeros años del siglo.

Portadilla (página 5), con el título divergente, al que no le hubiera sobrado un acento.

Una de las claves para ofrecer a un precio asumible por el lector al que iban destinado estos libros es evidente que fue relegar los procesos de preimpresión (la corrección de galeradas, en particular) a un lugar muy secundario si no inexistente (y agravado además por una premura en el proceso que era más propia de la prensa que de la edición de libros), y de ahí las erratas y transposiciones de renglones de los que Santonja ofrece algunos ejemplos jugosos en este pequeño volumen. El riesgo cultural que estaban asumiendo alegremente esta serie de editores emprendedores, que Santonja no comenta ni el objetivo de su libro propicia, era acostumbrar a los nuevos lectores que indudablemente estaban haciendo aparecer este tipo de iniciativas a un tipo de ediciones adocenadas en las que tenía más importancia la elección de un título y unas ilustraciones llamativos que la corrección o incluso la legibilidad del texto. Y todo por la causa.

Dedicatoria, a José Esteban, que como inapropiadamente indica el folio corresponde a la página 7.

Es evidente, para desgracia del lector de nuestros días, que esa es una tradición editorial que en España sigue contando con entusiastas epígonos (aunque sus «causas» son muy distintas), si bien a veces se parapetan tras la coartada del más glamuroso adjetivo «independientes».

Gonzalo Santonja, La novela revolucionaria de quiosco, 1905-1939, Madrid, La Productora de Ediciones-El Museo Universal, 1993.

Fuentes adicionales

AA.VV., Monteagudo, núm. 12 (2007), monográfco dedicado al centenario de El Cuento Semanal.

Fernández Menéndez, Raquel (2015). «Semblanza de Gregorio Pueyo (1860-1913)». En Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIX-XXI) – EDI-RED.

Manuel Martínez Arnaldos, Jesús A. Martínez Martín, «La edición moderna», en Historia de la edición en España, 1836-1936, Madrid, Marcial Pons, 2001, pp. 167-206.

Rivalan Guégo, Christine (2015). «Semblanza de Ramón Sopena López (1869- 1932)». En Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIXXXI) – EDI-RED.

 

La Editorial Rocas y el «descubrimiento» de Vargas Llosa

vargasllosajovenEl descubrimiento de Mario Vargas Llosa (n. 1936) ha quedado comúnmente asociado a la obtención del Premio Biblioteca Breve en 1962 con La ciudad y los perros (1962), que luego ganaría también el Premio de la Crítica, y a la labor de difusión que de su obra llevaron a cabo con tesón la agente Carmen Balcells (1930-2015) y el editor Carlos Barral (1928-1989).

Sin embargo, quienes por primera vez le permitieron entrever la posibilidad de acabar convirtiéndose en escritor profesional fueron los editores de la barcelonesa Editorial Rocas, que por aquel entonces estaba consiguiendo prestigiar un galardón destinado a libros de cuentos literarios, el Premio Leopoldo Alas, mediante el cual esta singular empresa se estaba haciendo con un cierto renombre entre las jóvenes promesas del género. La idea surgió de un grupo de curiosos escritores vinculados muchos de ellos profesionalmente a la medicina: el especialista en obstetricia y ginecología Martín Garriga Roca (1900-1980); el estomatólogo Esteve Padrós de Palacios (1925-2005), que se había iniciado como ayudante de Garriga en la asistencia a partos a domicilio, el también ginecólogo Manuel Carreras Roca (1915-1997), quien antes de la guerra se financió los estudios como futbolista del Llevant y el València, y el crítico literario y poeta Enrique Badosa. A Badosa y Padrós atribuyó específicamente Vargas Llosa la posibilidad de publicar su primer libro, y en realidad la Editorial Rocas, y muy particularmente la Colección Leopoldo Alas, de cuentos, dio a conocer algunos otros nombres importantes o apoyó de un modo decisivo a jóvenes narradores que no tardarían en destacar en la segunda mitad del siglo XX.

12cuentos

La mencionada colección se había estrenado en 1956 con 12 cuentos y 1 más, con el que se da a conocer Lauro Olmo (1921-1994), quien sin embargo ya había publicado en colaboración con Pilar Enciso (1919-2000) El león engañado y Cuno (en la colección Literatura de Juglaría, Madrid, Gráficas Bachende) y el poemario Del aire (en la colección Neblí que dirigían Rafael Millán y Felipe García Ibáñez) y quien poco después se ganaría un lugar destacado en la historia de la literatura española en el terreno de la literatura dramática (La camisa, 1960; La pechuga de la sardina, 1962; English Spoken, 1967, etc.). Entre las curiosidades de este volumen se cuenta un muy buen prólogo de Enrique Badosa y la indicación de la barcelonesa calle Ausias March, número 31 (esquina calle Girona), como sede de la editorial, pues coincide con el domicilio de la clínica en la que trabajaban Esteve Padrós y su hermano Eduard, y donde previamente había tenido la suya su padre, el oftalmólogo Jaume Padrós de Gaona (1885-1943). Según reza en la página 5 de este volumen, impreso en Socitra y encuadernado en rústica:

Doce cuentos y uno más, de Lauro Olmo, fue galardonado con el I Premio Leopoldo Alas para libros de cuentos literarios en Barcelona la noche del día 3 de marzo de 1956, por un jurado compuesto por don Martín Garriga, don Manuel Carreras, don Gonzalo Lloveras, don Manuel Pla y Salat, don Miguel Dalmau Ciria, don Juan Planas Cerdá, don Esteban Padrós de Palacios y don Enrique Badosa.

lauroolmo

La familia Olmo al ser deshauciados de Las Pozas en noviembre de 1972.

No deja de tener su interés y su punto subversivo la reivindicación del escritor Leopoldo Alas (1852-1901) implícita en el nombre elegido para el premio y la colección, pues vale la pena recordar que la obra magna de este autor, la novela La Regenta, estuvo prohibida por la censura franquista durante muchos años, y justo por aquel entonces, ese mismo año 1956, al editor Alfredo Herrero Romero (1924-1974) se le denegó la autorización de publicarla alegando en el informe de censura que «los verdaderos protagonistas de la obra son la simonía y la lujuria, que convierten un bellísimo idilio digno de Santa Teresa o San Juan de la Cruz en un torbellino de lascivias sacrílegas».

El tercer número de la colección Leopoldo Alas (el segundo es una antología de cuentos presentados al premio) lo ocupó en 1957 un libro de quien obtuvo el premio homónimo en su segunda convocatoria, Jorge Ferrer-Vidal Turull (con Sobre la piel del mundo, prologado por Padrós), quien en 1954 había despertado la atención de la crítica con la novela El trapecio de Dios, aparecida en la lujosa colección de Josep Janés (1913-1959) La Botella Errante. Y a este le seguirían, antes de la aparición de Los jefes, las primeras obras de una serie de autores que pueden más o menos inscribirse en un tipo de realismo de crítica social: La noticia (1958), de Manuel San Martín (1930-1963), quien dos años después sería finalista del Premio Planeta con El borrador (1960); Los desterrados (1958), de Ramon Nieto (n. 1934), que previamente había publicado sólo La Tierra y que en años posteriores desarrollaría una amplia labor editorial (en Santillana, Altea, la Unesco, Salvat, Alhambra); Aljaba, de Esteve Padrós, La rebusca y otras desgracias (1958), con el que se estrenaba en las letras de molde Daniel Sueiro (1931-1986), que al año siguiente obtendría el Premio Nacional de Literatura con Los conspiradores (reeditado en Menoscuarto en 2006) y Muertos y vivos, de Julián Gállego (1919-2006), que años más tarde ganaría el Leopoldo Alas con Apócrifos españoles (1967).

kurtzcamino

En un díptico sobre las primeras publicaciones de la colección, Eduardo Tijeras hacía un primer intento de señalar la tendencia predominante en esta colección de la Editorial Rocas, en unos términos muy de época y hoy bastante sorprendetes, y en la que se inscribiría Los jefes:

En lo referente a modismos dialogales, [Ferrer-Vidal] sigue una tendencia parecida a la de Olmo (recurrimos a la comparación para fijar y unificar de algún modo tales conceptos), es decir, que ambos gustan de poner en boca de sus personajes expresiones populares, barriobajeras, libertarias [sic] y magnetofónicas, lo que se ha venido en denominar realismo objetivo o cinematográfico, y que son, desde luego, acusadoras de un estado social vigente.

Y al libro inaugural del joven escritor peruano le seguirían otros libros no muy alejados de esta línea firmados por nombres tan notables como los de Víctor Mora (1931-2016), Ana María Matute (1925-2014), Carmen Kurtz (1911-1999) o Ignacio Aldecoa (1925-1969) entre los más destacados.

arrepentidamatuteEste es el contexto en el que se publica, pues, el primer libro de cuentos de Vargas Llosa, originalmente con prólogo de Joan Planas Cerdà, un dibujo de Clara Guillot y tan sólo cinco cuentos («Los jefes», «El desafío», «El hermano menor», «Día domingo» y «El abuelo»). El que habitualmente suele incorporarse en ediciones recientes, «Un visitante», se publicó por primera vez en la edición de la limeña Populibros Peruanos en 1963 en sustitución de «El abuelo», y fue en la edición también limeña de José Godard Editor cuando por primera vez el libro tomó la forma con que hoy es conocido, acogiendo los seis cuentos mencionados.

De escritura posterior a «Los jefes», «El abuelo» es sin embargo el primer cuento que había publicado Vargas Llosa, en las páginas de El Dominical del periódico de Lima El Comercio, el 9 de diciembre de 1956, y acerca del que posteriormente diría:

«El abuelo» desentona en este conjunto de historias adolescentes y machistas. También él es residuo de lecturas —dos bellos libros perversos de Paul Bowles: A delicate Prey y The Sheltering Sky— y de un verano limeño de gestos decadentes; íbamos al cementerio de medianoche, adorábamos a Poe y, en espera de hacer algún día satanismo, nos consolábamos con el espiritismo.

losjefesEn febrero del año siguiente «Los jefes», que el autor describió luego como «un eco desafinado de L’espoir de Malraux, que iba leyendo mientras lo escribía», apareció en forma de separata de la longeva revista Mercurio Peruano (fundada en 1918) que en aquellos años dirigía el reputado historiador peruano César Pacheco Vélez (1929-1989). Tampoco era inédito «El desafío», cuya historia editorial es un poco más compleja y se inicia cuando en 1957 lo presenta a un galardón convocado por la Revue Française y se lleva el premio (consistente en un viaje a París). Su primera aparición pública la hizo este cuento en el número 98 la mencionada revista en la traducción al francés llevada a cabo por el profesor André Coyné (1927-2015) y revisada por Georgette Marie Philippart Travers (1908-1984), más conocida como Georgette Vallejo por el hecho de ser la viuda de César Vallejo y haber logrado mantener a salvo y conservar a través de dos guerras (la civil española y la segunda mundial) el legado del poeta César Vallejo (1892-1938).

A estos tres cuentos añadió Vargas Llosa otros dos escritos más o menos por esos mismos años en el envío que desde Madrid preparó como candidatura al Premio Leopoldo Alas en su edición de 1958, en la que se alzó como vencedor y, según confesaba a Xavi Ayén, eso le decidió a tomar la seria determinación de hacerse escritor, y en términos muy similares se expresó en una entrevista con Leandro Pérez Miguel: «Ahí empezó mi vida de escritor, al menos oficialmente. Creo que [Los jefes] es un libro donde se ve una personalidad en proceso de formarse. Los jefes es un pequeño microcosmos de lo que vendrían a ser el resto de mis libros».

Es posible que la primera mención que aparece en prensa de la inminente aparición de este volumen sea la que se publicó en el número 115 de Cuadernos Hispanoamericanos (julio de 1959) del ya mencionado Eduardo Tijeras, que contiene una hoy chocante errata precisamente en el nombre del por entonces autor novel: «El último premio Leopoldo Alas, concedido recientemente al libro Los jefes, de Mariano Vargas, aún no ha visto la luz pública».

badosa

Enrique Badosa.

Sin embargo, los cuentos de ese joven peruano de veintipocos años reunidos en Los jefes están más cerca del estilo que caracterizaba las propuestas de la Editorial Rocas que de los derroteros que iría tomando la narrativa de Vargas Llosa en los años inmediatamente posteriores. Si bien es poco cuestionable el parentesco entre los ambientes, las atmósferas, los personajes e incluso los temas presentes en estos cuentos y los que aparecen en obras como La ciudad y los perros (1963) o Los cachorros (1967), uno de los más perspicaces miembros del jurado que le galardonó, Enrique Badosa, identificó retrospectivamente el que tal vez sea principal rasgo que marca un hiato entre este libro inicial y los posteriores, durante una conversación del autor con varios editores barceloneses en 1967:

En su primera obra, Los jefes […] emplea usted un estilo que se podría denominar convencional; esto es, un estilo en el que, desde fuera de la obra, el narrador describe personajes, hechos y diálogos. En Los cachorros, por el contrario, usted se sitúa, por así decirlo, en el seno mismo de lo relatado, más casi como sujeto paciente de su literatura que como sujeto agente. Por otra parte, en Los jefes la originalidad creadora era buscada, sobre todo, en la novedad del argumento, mientras que en Los cachorros esa originalidad se busca más en el cómo se dice lo que se dice.

Es muy conocido, porque se ha repetido muchas veces, que la sugerencia de presentar su segunda obra a Carlos Barral le llegó a Vargas Llosa en París a través del hispanista Claude Couffon (1926-2013), quien consideraba al por entonces director de Seix Barral el único capaz de conseguir que La ciudad y los perros pasara sin daños excesivos por la censura española, pero en cualquier caso es evidente que, debido a la línea editorial de Rocas, centrada en el cuento realista con un componente de crítica social, la evolución del escritor peruano no hubiera tardado en desentonar en el catálogo de quienes le descubrieron como narrador.

Aun así, el galardón y la publicación a Los jefes, añadida a la de obras primerizas de tantos otros autores que no tardarían en consagrarse mediante premios de mayor relumbrón, son muy indicativos del buen olfato y la intuición del grupo que gestionaba la Editorial Rocas, capitaneado por Enrique Badosa, quien poco después se convertiría en una de las piezas importantes de la editorial Plaza & Janés, sobre todo como director del departamento de Lengua Española y de las colecciones Selecciones de Poesía Española y Selecciones de Poesía Universal.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

El grueso de los autores del boom en Barcelona. Al fondo a la izquierda, al lado de Barral, puede verse a Vargas Llosa.

Fuentes:

Xavi Ayén, «Vargas Llosa: “Barcelona me hizo escritor”», La Vanguardia, 10 de octubre de 2010.

Enrique Badosa, Juan Ramón Masoliver, Joaquín Marco, Esther Tusquets, Carlos Barral y Jose María Castellet, «”Realismo” sin límites. Vargas Llosa, diálogo de amistad», Índice, núm. 224 (octubre de 1967, pp. 21-22. Recogido en Joaquín Marco y Jordi Gracia, eds., La llegada de los bárbaros. La recepción de la narrativa hispnoamericana en España, 1960-1981, Barcelona, Edhasa (El Puente), 2004, pp. 479-484.

Ernesto Mauri, «En recuerdo de Esteban Padrós de Palacios», Luke, núm. 97 (junio de 2008).

Leandro Pérez Miguel, «Mario Vargas Llosa: “Los jefes es un microcosmos del resto de mis libros”», El Mundo, 11 de agosto de 1999.

Eduardo Tijeras, «Noticia sobre el Premio Leopoldo Alas», Cuadernos Hispanoamericanos, núm. 115 (julio 1959), pp. 68-72.

Eduardo Tijeras, «Segunda noticia sobre la colección Leopoldo Alas», Cuadernos Hispanoamericanos, núm. 125 (mayo 1960), pp. 236-238.

Mario Vargas Llosa, «Acerca de mis primeros cuentos», en Lauro Zavala, ed., Teorías del cuento II: La escritura del cuento, México, Universidad Nacional Autónoma de México, Textos de Difusión Cultural. Serie El Estudio, 1995, pp. 207-212.

 

El acto de editar como acto de escritura/lectura. Entrevista a Gustavo Guerrero

Gustavo Guerrero (Caracas, 1957), profesor universitario, crítico literario y ensayista, escritor y consejero literario para el ámbito de la lengua española en Gallimard, desde hace ya varios años ha asistido desde una posición privilegiada a los procesos de internacionalización de la literatura española y latinoamericana, en los que París ha desempeñado un papel fundamental.

expo-sarduyguerrerowal176

Gustavo Guerrero y el editor François Wahl (1925-2014).

Llegas a París, habiéndote graduado en Derecho en la Universidad Andrés Bello, ¿qué te lleva a París?

En realidad, el viaje a París supuso una ruptura. Durante mis últimos años en Caracas vivía una doble vida: de día era un joven abogado especializado en derecho financiero (trabajaba en la colocación de bonos de la deuda pública en los mercados extranjeros) y de noche escribía reseñas y notas bibliográficas para el suplemento literario del periódico El Universal (por entonces uno de los más importantes de Venezuela) y también para otras publicaciones nacionales y extranjeras (entre ellas, la famosa Vuelta de Octavio Paz). Llegó un momento en que se hizo imposible seguir sirviendo a estas dos coronas.

genette

Gérard Genette (París, 1930).

La Fundación para la Cultura y las Artes de Caracas me ofreció una salida al otorgarme una beca de estudios en teoría y crítica literaria sobre la base de un dosier formado por mis artículos. Así salí de Venezuela y del mundo del derecho; así llegué a París y al departamento de teoría literaria de la Escuela de Altos Estudios en Ciencias Sociales. Pero el derecho y las finanzas no desaparecieron del todo. Han sido, por el contrario, dos herramientas esenciales para ejercer cabalmente el oficio de editor.

Cuando entras en la Escuela de Altos Estudios en Ciencias Sociales, Gerard Genette (n. 1930), que dirigió tanto tu licenciatura como tu doctorado, era ya una estrella de los estudios literarios, pero en 1982, justo cuando tú te diplomas, publica un ensayo tan influyente como el Palimpsestos. ¿Qué puedes contar del Genette profesor y de su influencia sobre tu modo de afrontar la literatura? Porque creo que proponía, sobre todo en Figuras III, un método de análisis de textos literarios muy útil y productivo.

Palimpsestos fue primero un seminario de dos o tres años en la Escuela, y luego una lectura capital. ¿Qué decía Genette en ese libro? Afirmaba que el sentido de una obra literaria no dependía de la sola estructura de su texto (algo que en aquel entonces aún parecía bastante herético) sino que variaba en función del entorno de ese texto y, en particular, de la manera como el objeto libro, a través de sus cubiertas, ilustraciones, cuartas de forro, solapas, etc., trataba de inducir o incluso de imponer una cierta interpretación. Para mí fue el descubrimiento de que el acto editorial podía ser un acto de escritura/lectura que implicaba la imposición de un sentido y secretaba (o trataba de secretar) un horizonte de recepción determinado. Editar era algo más que hacer libros; era conferir un sentido, formular una propuesta de lectura.

¿Cuáles eran tus experiencias editoriales cuando llegas a Gallimard?

logoduseuil

Logo de Éditions du Seuil, obra de Robert Lapoujade, que reproduce su sede entre 1945 y 2010: rue Jacob, 27.

Es una historia un poco larga. Antes de entrar a Gallimard, estuve trabajando durante tres años en Editions du Seuil. Allí me inicié en el oficio, junto a Severo Sarduy y a François Wahl. Todo partió de Genette, que también formaba parte del equipo de le Seuil (por entonces dirigía la colección Poétique). Recuerdo que el tema de mi tesina en la Escuela fue el concepto de neobarroco en la obra de Sarduy. Gracias al apoyo de Andrés Sánchez Robayna, ese trabajito universitario, algo retocado, se editó en Barcelona con el título rimbombante de La estrategia neobarroca (1988). Pero antes de que se publicara, Genette se lo envió al propio Sarduy y éste se lo dio a leer a François Wahl, que era como el gran mandarín de toda el área de humanidades y ciencias sociales en la editorial. Ambos me propusieron que leyera y redactara informes para las colecciones de literatura extranjera.

Fueron unos años inolvidables. Se trabajaba muy a gusto, dentro de un clima de efervescencia, camaradería e informalidad. Todavía soplaban los vientos libertarios del mayo francés por los corredores de la casita de la rue Jacob. Cada libro se leía y se discutía con rigor, con apasionamiento, como si todos participaran en una misma aventura literaria, cultural y política. Redactar un informe era como realizar un ejercicio de crítica en el que se daba por sentado que la responsabilidad de un editor no se limitaba a garantizar un nivel de ventas. Había también una responsabilidad intelectual de saber por qué se hacía lo que se hacía, cómo y para quién. En la rue Jacob aprendí así a redactar informes, cuartas de forro y solapas, comunicados de prensa y hasta documentos comerciales; pero sobre todo a Seuil le debo una idea de lo que significa editar.

croixdusud

Un ejemplo de La Croix du Sud de Caillois: Sécheresse, de Graciliano Ramos.

Tu entrada como director del ámbito de la lengua española en Gallimard se produce en 1996 para sustituir a Severo Sarduy (1937-1993). Por la fecha en que se produce esa llegada de Sarduy, probablemente por problemas de salud ya no tendría ocasión de desarrollar grandes proyectos, pero aun así crea la Nouvelle Croix du Sud (1991-1995), que venía a revitalizar la Croix du Sud (1952-1970) iniciada por Roger Callois (1913-1978) a su regreso de Argentina.

A fines de los ochenta, Sarduy estaba ya muy enfermo y le era muy difícil llevar adelante el proyecto. Su idea era sin embargo original: la Nueva Cruz del Sur debía ser como una meta-colección que releyera críticamente, a veinte años de intervalo, la colección de Caillois. Por un lado, Sarduy pretendía poner en tela de juicio el aspecto pedagógico del latinoamericanismo de Caillois (habría que recordar que la colección de Caillois publicaba a la vez ensayos culturales sobre América Latina y novelas que debían ilustrar las realidades del continente); por otro, Sarduy aspiraba a ampliar y a actualizar la percepción que se podía tener de la literatura latinoamericana en Francia en aquel momento, editando autores anteriores o posteriores al boom, como Macedonio Fernández y César Aira, como Leopoldo Marechal y Luis Rafael Sánchez.

En 1990, cuando Sarduy deja le Seuil por Gallimard, me pide que ocupe el lugar de lector principal en su nuevo equipo. Así llego a Gallimard. Mi papel fue, en un comienzo, el del lector que debía ir buscando a los nuevos autores, pero la enfermedad de Sarduy hizo que la gestión del proyecto fuera cada vez más difícil dentro del equipo y que la nueva colección no consiguiera afirmarse como una propuesta viable. Cuando en 1993 muere Sarduy, aún quedan algunos títulos por publicar y hay que ocuparse de ellos. Mi intención era editar esos títulos pendientes y luego marcharme a los Estados Unidos, a seguir una carrera universitaria allí. Ese fue el plan hasta que, en 1996, Antoine Gallimard me encargó la gestión editorial de toda el área iberoamericana en la colección Du Monde Entier.

nouvellecroixdusud

Un ejemplo de la Nouvelle Croix du Sud.

Con antecedentes tan ilustres en el cargo, como Valéry Larbaud, Héctor Bianciotti, Caillois o Sarduy, su legado en Gallimard debía de resultar de entrada un poco intimidatorio o imponía un nivel de exigencia bastante alto en cuanto a la literatura americana en español, ¿no? ¿Qué sesgo nuevo pretendías darle o cuál era tu intención respecto de las letras en lengua española en Gallimard?

Digamos que las cosas se fueron haciendo gradualmente, lo que les quitó peso y presión. Además, no eran ya los mismos tiempos ni los mismos públicos, ni tampoco la misma editorial. El fracaso de la Nueva Cruz del Sur me sirvió para entender que ya no se podía seguir defendiendo el principio de una colección latinoamericana al margen de las colecciones generales de literaturas extranjeras, como Du Monde Entier. Había que partir del fondo excepcional de autores iberoamericanos que teníamos (y tenemos) en esa colección y pensar una política destinada a preservarlo, renovarlo y ampliarlo. Preservarlo significaba entonces (y significa ahora) conservar dentro de la casa a los autores principales del catálogo: Borges, Cortázar, Onetti, Cabrera Infante, Paz, Fuentes, Vargas Llosa… Había que seguir publicando sus obras y garantizarles una presencia continua. Esa fue mi primera línea de trabajo.

Luego, estaba (y está) la segunda: la renovación del fondo a través de nuevas traducciones de algunos clásicos, como Rulfo, por ejemplo, o Josep Pla. Se trataba (se trata) de transformar en ventaja lo que es un problema para el editor de literatura extranjera: el envejecimiento acelerado de las traducciones.

En fin, la tercera línea de mi trabajo editorial fue (y es) la ampliación del fondo con la incorporación de dos tipos de autores: los ya altamente consagrados y canónicos, como Ricardo Piglia, Javier Marías o Sergio Pitol, y las figuras más recientes que son objeto de un cierto consenso crítico, como Yuri Herrera, Hernán Ronsino, Rodrigo Blanco Calderón y Samantha Schweblin, para citar solo a los más recientes.

cailloisocampo

Roger Caillois y Silvina Ocampo (1903-1993).

¿La reivindicación que a menudo se hace de España como puente entre la creación latinoamericana y los mercados europeos, que en relación a lo que conocemos como el boom quizá sea menos controvertido, hasta qué punto se corresponde, históricamente, con la realidad o es una exageración? ¿Cómo ha sido, históricamente, la relación entre los escritores en español y los lectores franceses?

La relación con el público francés es una vieja y buena relación, que se ha ido renovando a través de los años. Los autores de lengua española se traducen, se editan y son muy leídos dentro de un cierto sector del mercado que no se puede comparar con el de los autores anglos, claro, pero que está lejos de ser insignificante.

Sobre el papel de España como puente hacia los mercados europeos y la verdadera historia del boom, habría que matizar mucho e investigar más. Creo que se ha exagerado demasiado. El boom fue un fenómeno complejo y global en el que no hubo un solo actor sino varios. Y el protagonismo entre distintas plazas (Buenos Aires, México, La Habana, Barcelona, Paris) fue compartido. Hoy la situación también se hace cada vez más compleja y global, pues ya España no tiene el monopolio de la venta de los derechos de traducción de autores latinoamericanos, ni París es ya la única vitrina de la literatura mundial. Tanto el capital simbólico como el capital económico están más dispersos y la producción de valor, a nivel global, se ha fragmentado y atomizado. Es más difícil llegar a consensos críticos. Mira, si no, las interminables y dispares listas con que la prensa internacional nos castiga cada fin de año en París, Barcelona, Buenos Aires, Nueva York, México o Madrid.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

De izquierda a derecha: Castellet, García Márquez, Barral, Vargas Llosa, Félix de Azúa, Salvador Clotas, Cortázar y García Hortelano.

En el caso del boom, se asume a menudo que el espacio clave es Barcelona, y la agencia de Carmen Balcells en particular, para su internacionalización. Pero parece lógico pensar que sin traducciones podría haber quedado circunscrito al ámbito hispanohablante, y no fue el caso. ¿Qué pesa más en esa internacionalización, el hecho de que autores como Cortázar residan en París o la existencia de una larga tradición de relaciones entre Latinoamérica y Francia, quizá peor conocida? ¿Qué papel atribuyes en ello a Carmen Balcells?

Carmen Balcells transformó la venta de derechos de traducción en un negocio global. Su modelo fue el del marchant d’art que se implicaba en la vida y la obra de los artistas que representaba y los acompañaba en su aventura creativa. En este sentido, era una mujer notabilísima, que respetaba a sus autores, los conocía y conocía la literatura cuyos derechos de traducción negociaba. Ahora bien, sin el contexto internacional que trajo consigo la Revolución Cubana, sin la potencia y la experiencia del polo editorial de Buenos Aires (ahí estaban Sudamericana, Losada y tantas otras casas), sin las traducciones de la colección de Roger Caillois (que circulaban por toda Europa y llegaban a los Estados Unidos), sin Carlos Barral y sus premios, y en fin… sin tantos otros factores, como el genio de Cortázar, García Márquez y Vargas Llosa, sin todo esto no habría habido ningún boom. Así que no exageremos tanto, por mucho que queramos a Carmen y que nos guste Barcelona.

castelletvalverdepetitbarralvseix

De izquierda a derecha: Castellet, José M. Valverde, Joan Petit, Barral y Víctor Seix.

Lo que sí habría que subrayar es que Carmen, como la mayoría de las agentes españolas, era ante todo una gran lectora de sus autores, los conocía y conocía perfectamente sus obras, y cuando hablaba con un editor extranjero, sabía de qué le estaba hablando y sabían también con quién estaba hablando. Por encima de todo, era una mujer que conocía y amaba la literatura que se escribe en español en las dos orillas de la lengua. No siempre es el caso hoy, ya que la venta de derechos está a veces en manos de agentes que no leen el español ni saben nada de sus literaturas ni se interesan de veras en nuestros escritores; o solo saben hablar de su potencial comercial.

Posteriormente, enterrado ya Franco, París volvió a ser un núcleo de difusión importante en relación a la promoción de escritores españoles como Muñoz Molina (n. 1956), Julio Llamazares (n. 1955), Juan José Millás (n. 1952), Javier Marías (n. 1952), Luis Landero (n. 1948), etc., ¿no?

Rafael Conte (1935-2009).

Es cierto. Allá por los ochenta, cuando trabajaba en le Seuil, la promoción de la nueva ola española fue una de nuestras prioridades. Rafael Conte, amigo de la casa, hizo mucho por ellos. También José Miguel Ullán. Recuerdo el lanzamiento de las novelas de Eduardo Mendoza, o de los libros de la cuentista Cristina Fernández Cubas en París. Fue un gran momento de la narrativa española en Francia. Y creo que tuvo repercusiones en toda Europa, ciertamente.

 

En el caso de la literatura catalana, lo habitual es ampliar los lectores mediante la traducción primero al español, pero no fue ese el caso de Joan Sales y su Incerta glòria, cuya primera traducción fue la de Bernard Lesfargues al francés como Gloire incertaine en 1962 (la española, de Carlos Pujol, tuvo que esperar hasta 1969), pero que gracias a que apareció en una editorial como Gallimard luego fue contratada enseguida en otros países. Hay una vocación explícita, parece, de actuar desde Gallimard como puente entre culturas a través de las traducciones, ¿no es así?

Pascale Casanova habla en su libro La République Mondiale des Lettres (1998) del «efecto París», para referirse al impacto simbólico que supone, a un nivel internacional, la traducción al francés de un autor extranjero. No sé si todavía París tiene esa potestad, pero tradicionalmente las traducciones que publica Gallimard sí han tenido ese efecto canónico, un suplemento evaluativo reconocido por premios internacionales como el Nobel. La correspondencia de Caillois con muchos editores extranjeros constituye un registro de este modo de circulación de las traducciones francesas y de la atención que se les prestaba, que aún se les presta, a nivel internacional.

En la misma colección donde Gallimard sitúa, por ejemplo, las obras de Sándor Márai, Pasternak, Faulkner o Kundera, Du Monde Entier, puede encontrarse el Cahier gris de Josep Pla, Frémisante mémoire de Jesús Moncada, La place du Diamant, de Mercè Rodoreda. Y el tándem Ramón Chao-Serge Mestre ha traducido directamente del gallego varias obras de Manuel Rivas en diversas colecciones de Gallimard, que al parecer han sido en general bien acogidas. ¿Estas obras en otras lenguas peninsulares, llegan a Gallimard a través de traducciones previas al español, o hay una mirada puesta en el canon y las novedades de las literaturas gallega y catalana?

salesgallimard1962Sí se les ha dado una atención especial a las lenguas de la Península. Manuel Rivas se traduce en Gallimard directamente del gallego, como Moncada y Pla del catalán. Desde 1996 he tratado de tener siempre en mi equipo lectores de las diversas lenguas peninsulares y también de portugués, por supuesto. Rivas y Pla, entre otros, han sido acogidos con bastante éxito. De hecho, una de las aventuras editoriales más felices de estos últimos años fue la traducción integral del Quadern Gris, que solo se conocía en francés en una versión fragmentaria y muy reducida. Pla faltaba en el catálogo de Gallimard y traerlo fue como cumplir con una deuda pendiente para con un autor tan excepcional y tan francófilo. Sueño con traducir un día sus libros de vagabundeos gastronómicos.

Hay una impresión bastante generalizada de que en Francia hay un mayor reconocimiento hacia la labor del traductor, ¿responde eso a la realidad y, en tal caso, a qué lo atribuyes? Podría sorprender que en las traducciones francesas suele indicarse en los créditos si la traducción es del español de Chile, de Argentina, de Colombia o de México, ¿cómo encaja eso con la pretendida unidad de la lengua española?

Los traductores franceses han sostenido durante muchos años un largo combate para que se reconozcan sus derechos. Hoy se les tiende a considerar cada vez más como re-escritores y por ende como co-creadores de la obra que traducen. De ahí que su nombre aparezca sistemáticamente junto al del autor en las portadillas y los créditos. Me parece más que justo. Necesario.

También era justo y necesario hacerle un lugar a las variaciones del español y a los diversos españoles americanos. Siempre se indica en la portada, cuando se traduce del español, si procede de México, Cuba, Chile, etc. La lingüística reconoce la importancia de estas modalidades más allá o más acá de la unidad de la lengua, que es sobre todo un asunto político, no literario ni editorial ni científico.

josephinefelliermarcellinkristevabartheswahlsarduy

De izquierda a derecha: Josephine Fellier, Julia Kristeva, Roland Barthes, François Wahl y Severo Sarduy en los tiempos de Tel Quel.

En tanto que editor, no estrictamente como lector, ¿qué editor o editores te parece que por su modo de enfocar el trabajo, su talante o su obra te han servido de modelos o has aprendido de ellos?

Son muchos y es difícil no ser desagradecido e injusto. Ya te hablé de Sarduy y de Wahl. A ambos les debo una cierta fidelidad a las estéticas y al pensamiento de vanguardia. También los Gallimard han sido un modelo por la manera como reparten el peso entre el valor literario y las expectativas económicas: «encuentre usted buenos libros y el servicio comercial encontrará la forma de venderlos», me dijo Antoine Gallimard en nuestra primera entrevista.

Tendría que citar asimismo a Jorge Herralde por razones semejantes: en medio del huracán neoliberal, entre los noventa y dos mil, la literatura siguió siendo un valor en el catálogo de Anagrama y hoy se puede leer en él una propuesta de escritura/lectura arriesgada, influyente y sólida. No debería olvidar tampoco a los dos Manolos de Pre-Textos, Borrás y Ramírez, que desde Valencia nos siguen dando lo mejor de la poesía y el pensamiento contemporáneo contra viento y marea. Se me ocurren tantos otros nombres de colegas y amigos tan notables y tan diferentes, como Pilar Reyes y Jaume Vallcorba, como Joan Tarrida y Juan Casamayor; de todos ellos he aprendido algo en distintos momentos de estos años.

canagrama

De izquierda a derecha: Gustavo Guerrero, Lali Gubern y Jorge Herralde en la Feria de Frankfurt 2012.

Entre las generaciones más recientes, habría que citar a editores latinoamericanos como Leonora Djament de Eterna Cadencia, Eduardo Rabasa de Sexto Piso o Matías Rivas de la Diego Portales, que asocian la publicación de ensayos de humanidades, teoría y ciencias sociales, con literatura de la más alta exigencia. De hecho, algunas de las voces claves entre las nuevas generaciones de narradores y ensayistas han salido de esos catálogos. Acaso el factor común que los une es una apuesta por la innovación en pos de otro equilibrio entre las dos caras del oficio editorial – la comercial y la intelectual – después de unos años en que parecía que el afán de rentabilidad y los grandes conglomerados lo iban a devorar todo.

Algunos críticos literarios y profesores muy vinculados al sector editorial evitan ejercer la crítica literaria cuando esta puede entrar en conflicto con autores representados, editados o incluso con amigos, y de ahí que sólo reseñen obras de autores que, en ese plano y también en el académico, les quedan lejos. Tú, en cambio, tanto en la Nouvelle Revue Française como en Cuadernos Hispanoamericanos o Letras Libres siempre te has ocupado de las novedades de la literatura hispanoamericana, que ha sido también tu campo preferente tanto en la universidad como en el sector editorial. ¿Cómo se lleva esa cuádruple vertiente de escritor, editor, profesor y crítico literario? ¿No se producen ciertas tensiones en el momento de enjuiciar la obra de autores próximos en alguno de esos sentidos?

Tienes toda la razón. Claro que se produce una cierta tensión cuando se ocupan tantos lugares a la vez en el campo literario y hasta puede haber cierto conflicto de intereses. Esto me ha llevado a reducir drásticamente la publicación de reseñas y artículos de crítica en los últimos años, muy a mi pesar porque llegué a la edición a través de la crítica literaria y porque esa vocación primera sigue siendo con la que más me identifico y la que me ha dado más satisfacciones.

Además, el tener que leer continuamente todo lo que se está publicando dentro de área hispánica suele darte una visión bastante privilegiada de lo que se está escribiendo en un momento dado. Si no he descartado del todo seguir haciendo crítica, es porque, como te decía, veo al acto de editar como una continuación o prolongación del gesto crítico por otras vías: es una propuesta de escritura/lectura que, como la de una reseña o un artículo, puede ser más o menos acertada y recibir una acogida favorable o desfavorable. Por eso a veces me permito escribir sobre los autores que edito, en revistas españolas o latinoamericanas y aun ocurre que los incluya en algún curso o seminario universitario. Es otra manera de publicar y de compartir una propuesta de escritura/lectura. También me permito escribir sobre autores a los que no edito por una razón u otra, pero cuyas obras me interesan o entusiasman.

grupoeds

De izquierda a derecha: Elizardo Martinez (Ediciones El Callejón), Gustavo Guerrero, Leonora Djament (Eterna Cadencia), Juan Casamayor (Paginas de Espuma), Antonio José Ponte (El Diario de Cuba) y Eduardo Rabasa (Sexto Piso), en marzo de 2016

Fuentes adicionales:

Catherine Fel, «Entretien avec Gustavo Guerrero, responsable du domain hispanophone chez Gallimard», Bureau International de L´Édition Française, marzo de 2009.

Gustavo Guerrero «Vivimos una tendencia a la novelización», entrevista en vídeo en Casa América, 7 de octubre de 2011.

guerreroanagrama

Libro con el que Gustavo Guerrero obtuvo el Premio Anagrama de Ensayo 2008.

Gustavo Guerrero, «La mediación editorial, la traducción y la difusión de las literaturas latinoamericanas en Francia: el proyecto Medet-Lat France. 1950-2000», conferencia en el Seminario Internacional Redes públicas, relaciones editoriales. Hacia una historia cultural de la edición iberoamericana, 22 de noviembre de 2016.

María Pizarro Prada, «4 preguntas a Gustavo Guerrero», en el blog de Iberoamericana/Vervuert, 5 de noviembre de 2012.

Susana Reinoso, «Gallimard y los lectores», publicado en Ñ, y en Función Lenguaje (sin indicación de fecha).

Web sobre la historia de Gallimard, de la colección Du Monde Entier y web de Éditions du Seuil.