Literatura «de quiosco», «revolucionaria», editoriales «de avazada»…

Al igual que la «literatura de cordel» o el «folletín», existen y empleamos habitualmente algunas categorías que –tradicionalmente o por lo menos en su origen– han sido fronterizas entre la descripción de los principales rasgos de los texto, por un lado, y su soporte, su forma de distribución o incluso sus puntos de venta principales por el otro, como es el caso por ejemplo de la literatura de quiosco, que tal vez para generaciones distintas alude a un tipo de novelas, relatos o textos de divulgación sensiblemente distintos (sicalípticas, de literatura juvenil, de relatos del oeste, etc.).

Eduardo Zamacois (Pinar del Río, Cuba, 1893-Buenos Aires, 1971).

En un libro panorámico centrado en la literatura revolucionaria (otro término conflictivo) publicada con destino a este sistema de venta, y titulado como no podía ser de otra manera, La novela revolucionaria de quiosco (1905-1939), Gonzalo Santonja rescató de las tan poco leídas memorias de Eduardo Zamacois (1873-1971) su testimonio acerca de los avatares del que suele considerarse el primer ejemplo de este género, subgénero o categoría literaria, El Cuento Semanal. Previamente, Alfonso Sastre (n. 1926) se refiere en el prólogo a este libro a la «fórmula Zamacois», pero el caso es que en realidad esta tardó en encontrar la financiación y la infraestructura necesaria para poder ponerse en marcha. La visionaria idea de una colección de muy bajos coste, de libros muy breves, ilustrados, de periodicidad semanal y cuyos potenciales lectores, no necesariamente habituales de las librerías, pudieran encontrar en puntos de venta que frecuentaban para otros menesteres fue rechazada sucesivamente por Ramón Sopena (1869-1932), Gregorio Pueyo (1860-1913) y también por el filósofo y periodista de origen cubano José del Perojo (1850-1908), de Mundo Nuevo, antes de que, gracias a la participación como inversor del también periodista Antonio Galiardo (en agradecimiento a su entrada en el periódico La Publicidad, merced a la intervención de Zamacois), pudiera convertirse en realidad esta colección, que se estrenó el primer día del año 1907 con Desencanto, del escritor y pintor Octavio Picón (1852-1923), quien por aquel entonces tenía a sus espaldas ya una formidable obra como narrador de títulos más o menos inequívocos (La hijastra del amor, 1884; La honrada, 1890; Dulce y Sabrosa, 1891; Drama de familia, 1903…).

El contenido del libro de Santonja es fiel al título que figura en la portada de la primera edición –por cierto: no coincidente con el de la cubierta, que a su vez sí coincide con el subtítulo de una edición del año 2000 SIAL Ediciones–, «Notas para la historia de la novela revolucionaria de quiosco en España (1905-1939)», pues en este breve volumen el autor se centra en unos cuantos casos muy significativos de esta «categoría» o «subcategoría» literaria: El Cuento Semanal de Zamacois, La Novela Roja de Fernando Pintado, La Novela Ideal de la familia Montseny, La Novela Política de Prensa Gráfica, La Novela de Hoy de Artemio Precioso (1891-1945) y unos pocos más, así como en algunas iniciativas nacidas anejas a este tipo de ámbitos editoriales, como es el caso en particular de ciertas novelas de autoría colectiva.

La relativa insatisfacción que pudiera tener el lector interesado en esta materia procede precisamente de ese carácter de notas un poco inconexas, valiosas y útiles en sí mismas pero que constituyen una serie de capítulos escasamente engarzados o articulados para dar respuesta a las preguntas implícitas que se derivan de la lectura del libro.

Pero más allá de quedar esa historia de la literatura revolucionaria en una eterna promesa de la que sin embargo han ido llegando aproximaciones parciales (muchas de ellas del propio Santonja, que recupera fragmentos de este texto en otros títulos y artículos suyos, pero también debidas a José Carlos Mainer, José Esteban, Marisa Siguán, Amelina Correa Ramón y Martínez Arnaldos, entre otros), uno de los mayores intereses de este tipo de aproximaciones es, además de ofrecer listados de las obras publicadas (muy útiles en ausencia de catálogos) y de aportar cuantiosa información acerca del funcionamiento de empresas, obras y autores poco y mal conocidos (en ocasiones debido a la proliferación del empleo del anonimato y de seudónimos en esa época y en esos géneros), no limitarse al estudio de los textos, sino también a establecer los vínculos entre una determinada ideología, unos géneros literarios con unos rasgos bastante bien definidos (y deudores de unas tradiciones fácilmente identificables) y unos determinados sistemas de producción y distribución estrechamente relacionados si no deudores de la configuración de las empresas periodísticas, de la reestructuración de la industria papelera y de los avances y crecimiento de los servicios de impresión. En otras palabras, ofrecer una imagen que tienen tanto en cuenta el sistema editorial como el campo literario.

En realidad este breve libro de Santonja, reeditado en 2000 con diferente título, es una pieza más en la explicación del modo en que se concebía el libro en España en las primeras décadas del siglo XX que resulta indispensable para comprender mínimamente la eclosión posterior de las llamadas –probablemente mal llamadas– «editoriales de avanzada (Ediciones Oriente), cuyo objetivo central era la difusión de la literatura y el pensamiento social y revolucionario a finales de los años veinte y en la década de los treinta», en palabras de Martínez Martín, y cuyos protagonistas en muchas ocasiones ya se habían fogueado en labores editoriales o empresariales en estas mismas iniciativas de los primeros años del siglo.

Portadilla (página 5), con el título divergente, al que no le hubiera sobrado un acento.

Una de las claves para ofrecer a un precio asumible por el lector al que iban destinado estos libros es evidente que fue relegar los procesos de preimpresión (la corrección de galeradas, en particular) a un lugar muy secundario si no inexistente (y agravado además por una premura en el proceso que era más propia de la prensa que de la edición de libros), y de ahí las erratas y transposiciones de renglones de los que Santonja ofrece algunos ejemplos jugosos en este pequeño volumen. El riesgo cultural que estaban asumiendo alegremente esta serie de editores emprendedores, que Santonja no comenta ni el objetivo de su libro propicia, era acostumbrar a los nuevos lectores que indudablemente estaban haciendo aparecer este tipo de iniciativas a un tipo de ediciones adocenadas en las que tenía más importancia la elección de un título y unas ilustraciones llamativos que la corrección o incluso la legibilidad del texto. Y todo por la causa.

Dedicatoria, a José Esteban, que como inapropiadamente indica el folio corresponde a la página 7.

Es evidente, para desgracia del lector de nuestros días, que esa es una tradición editorial que en España sigue contando con entusiastas epígonos (aunque sus «causas» son muy distintas), si bien a veces se parapetan tras la coartada del más glamuroso adjetivo «independientes».

Gonzalo Santonja, La novela revolucionaria de quiosco, 1905-1939, Madrid, La Productora de Ediciones-El Museo Universal, 1993.

Fuentes adicionales

AA.VV., Monteagudo, núm. 12 (2007), monográfco dedicado al centenario de El Cuento Semanal.

Fernández Menéndez, Raquel (2015). «Semblanza de Gregorio Pueyo (1860-1913)». En Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIX-XXI) – EDI-RED.

Manuel Martínez Arnaldos, Jesús A. Martínez Martín, «La edición moderna», en Historia de la edición en España, 1836-1936, Madrid, Marcial Pons, 2001, pp. 167-206.

Rivalan Guégo, Christine (2015). «Semblanza de Ramón Sopena López (1869- 1932)». En Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIXXXI) – EDI-RED.

 

La Editorial Rocas y el «descubrimiento» de Vargas Llosa

vargasllosajovenEl descubrimiento de Mario Vargas Llosa (n. 1936) ha quedado comúnmente asociado a la obtención del Premio Biblioteca Breve en 1962 con La ciudad y los perros (1962), que luego ganaría también el Premio de la Crítica, y a la labor de difusión que de su obra llevaron a cabo con tesón la agente Carmen Balcells (1930-2015) y el editor Carlos Barral (1928-1989).

Sin embargo, quienes por primera vez le permitieron entrever la posibilidad de acabar convirtiéndose en escritor profesional fueron los editores de la barcelonesa Editorial Rocas, que por aquel entonces estaba consiguiendo prestigiar un galardón destinado a libros de cuentos literarios, el Premio Leopoldo Alas, mediante el cual esta singular empresa se estaba haciendo con un cierto renombre entre las jóvenes promesas del género. La idea surgió de un grupo de curiosos escritores vinculados muchos de ellos profesionalmente a la medicina: el especialista en obstetricia y ginecología Martín Garriga Roca (1900-1980); el estomatólogo Esteve Padrós de Palacios (1925-2005), que se había iniciado como ayudante de Garriga en la asistencia a partos a domicilio, el también ginecólogo Manuel Carreras Roca (1915-1997), quien antes de la guerra se financió los estudios como futbolista del Llevant y el València, y el crítico literario y poeta Enrique Badosa. A Badosa y Padrós atribuyó específicamente Vargas Llosa la posibilidad de publicar su primer libro, y en realidad la Editorial Rocas, y muy particularmente la Colección Leopoldo Alas, de cuentos, dio a conocer algunos otros nombres importantes o apoyó de un modo decisivo a jóvenes narradores que no tardarían en destacar en la segunda mitad del siglo XX.

12cuentos

La mencionada colección se había estrenado en 1956 con 12 cuentos y 1 más, con el que se da a conocer Lauro Olmo (1921-1994), quien sin embargo ya había publicado en colaboración con Pilar Enciso (1919-2000) El león engañado y Cuno (en la colección Literatura de Juglaría, Madrid, Gráficas Bachende) y el poemario Del aire (en la colección Neblí que dirigían Rafael Millán y Felipe García Ibáñez) y quien poco después se ganaría un lugar destacado en la historia de la literatura española en el terreno de la literatura dramática (La camisa, 1960; La pechuga de la sardina, 1962; English Spoken, 1967, etc.). Entre las curiosidades de este volumen se cuenta un muy buen prólogo de Enrique Badosa y la indicación de la barcelonesa calle Ausias March, número 31 (esquina calle Girona), como sede de la editorial, pues coincide con el domicilio de la clínica en la que trabajaban Esteve Padrós y su hermano Eduard, y donde previamente había tenido la suya su padre, el oftalmólogo Jaume Padrós de Gaona (1885-1943). Según reza en la página 5 de este volumen, impreso en Socitra y encuadernado en rústica:

Doce cuentos y uno más, de Lauro Olmo, fue galardonado con el I Premio Leopoldo Alas para libros de cuentos literarios en Barcelona la noche del día 3 de marzo de 1956, por un jurado compuesto por don Martín Garriga, don Manuel Carreras, don Gonzalo Lloveras, don Manuel Pla y Salat, don Miguel Dalmau Ciria, don Juan Planas Cerdá, don Esteban Padrós de Palacios y don Enrique Badosa.

lauroolmo

La familia Olmo al ser deshauciados de Las Pozas en noviembre de 1972.

No deja de tener su interés y su punto subversivo la reivindicación del escritor Leopoldo Alas (1852-1901) implícita en el nombre elegido para el premio y la colección, pues vale la pena recordar que la obra magna de este autor, la novela La Regenta, estuvo prohibida por la censura franquista durante muchos años, y justo por aquel entonces, ese mismo año 1956, al editor Alfredo Herrero Romero (1924-1974) se le denegó la autorización de publicarla alegando en el informe de censura que «los verdaderos protagonistas de la obra son la simonía y la lujuria, que convierten un bellísimo idilio digno de Santa Teresa o San Juan de la Cruz en un torbellino de lascivias sacrílegas».

El tercer número de la colección Leopoldo Alas (el segundo es una antología de cuentos presentados al premio) lo ocupó en 1957 un libro de quien obtuvo el premio homónimo en su segunda convocatoria, Jorge Ferrer-Vidal Turull (con Sobre la piel del mundo, prologado por Padrós), quien en 1954 había despertado la atención de la crítica con la novela El trapecio de Dios, aparecida en la lujosa colección de Josep Janés (1913-1959) La Botella Errante. Y a este le seguirían, antes de la aparición de Los jefes, las primeras obras de una serie de autores que pueden más o menos inscribirse en un tipo de realismo de crítica social: La noticia (1958), de Manuel San Martín (1930-1963), quien dos años después sería finalista del Premio Planeta con El borrador (1960); Los desterrados (1958), de Ramon Nieto (n. 1934), que previamente había publicado sólo La Tierra y que en años posteriores desarrollaría una amplia labor editorial (en Santillana, Altea, la Unesco, Salvat, Alhambra); Aljaba, de Esteve Padrós, La rebusca y otras desgracias (1958), con el que se estrenaba en las letras de molde Daniel Sueiro (1931-1986), que al año siguiente obtendría el Premio Nacional de Literatura con Los conspiradores (reeditado en Menoscuarto en 2006) y Muertos y vivos, de Julián Gállego (1919-2006), que años más tarde ganaría el Leopoldo Alas con Apócrifos españoles (1967).

kurtzcamino

En un díptico sobre las primeras publicaciones de la colección, Eduardo Tijeras hacía un primer intento de señalar la tendencia predominante en esta colección de la Editorial Rocas, en unos términos muy de época y hoy bastante sorprendetes, y en la que se inscribiría Los jefes:

En lo referente a modismos dialogales, [Ferrer-Vidal] sigue una tendencia parecida a la de Olmo (recurrimos a la comparación para fijar y unificar de algún modo tales conceptos), es decir, que ambos gustan de poner en boca de sus personajes expresiones populares, barriobajeras, libertarias [sic] y magnetofónicas, lo que se ha venido en denominar realismo objetivo o cinematográfico, y que son, desde luego, acusadoras de un estado social vigente.

Y al libro inaugural del joven escritor peruano le seguirían otros libros no muy alejados de esta línea firmados por nombres tan notables como los de Víctor Mora (1931-2016), Ana María Matute (1925-2014), Carmen Kurtz (1911-1999) o Ignacio Aldecoa (1925-1969) entre los más destacados.

arrepentidamatuteEste es el contexto en el que se publica, pues, el primer libro de cuentos de Vargas Llosa, originalmente con prólogo de Joan Planas Cerdà, un dibujo de Clara Guillot y tan sólo cinco cuentos («Los jefes», «El desafío», «El hermano menor», «Día domingo» y «El abuelo»). El que habitualmente suele incorporarse en ediciones recientes, «Un visitante», se publicó por primera vez en la edición de la limeña Populibros Peruanos en 1963 en sustitución de «El abuelo», y fue en la edición también limeña de José Godard Editor cuando por primera vez el libro tomó la forma con que hoy es conocido, acogiendo los seis cuentos mencionados.

De escritura posterior a «Los jefes», «El abuelo» es sin embargo el primer cuento que había publicado Vargas Llosa, en las páginas de El Dominical del periódico de Lima El Comercio, el 9 de diciembre de 1956, y acerca del que posteriormente diría:

«El abuelo» desentona en este conjunto de historias adolescentes y machistas. También él es residuo de lecturas —dos bellos libros perversos de Paul Bowles: A delicate Prey y The Sheltering Sky— y de un verano limeño de gestos decadentes; íbamos al cementerio de medianoche, adorábamos a Poe y, en espera de hacer algún día satanismo, nos consolábamos con el espiritismo.

losjefesEn febrero del año siguiente «Los jefes», que el autor describió luego como «un eco desafinado de L’espoir de Malraux, que iba leyendo mientras lo escribía», apareció en forma de separata de la longeva revista Mercurio Peruano (fundada en 1918) que en aquellos años dirigía el reputado historiador peruano César Pacheco Vélez (1929-1989). Tampoco era inédito «El desafío», cuya historia editorial es un poco más compleja y se inicia cuando en 1957 lo presenta a un galardón convocado por la Revue Française y se lleva el premio (consistente en un viaje a París). Su primera aparición pública la hizo este cuento en el número 98 la mencionada revista en la traducción al francés llevada a cabo por el profesor André Coyné (1927-2015) y revisada por Georgette Marie Philippart Travers (1908-1984), más conocida como Georgette Vallejo por el hecho de ser la viuda de César Vallejo y haber logrado mantener a salvo y conservar a través de dos guerras (la civil española y la segunda mundial) el legado del poeta César Vallejo (1892-1938).

A estos tres cuentos añadió Vargas Llosa otros dos escritos más o menos por esos mismos años en el envío que desde Madrid preparó como candidatura al Premio Leopoldo Alas en su edición de 1958, en la que se alzó como vencedor y, según confesaba a Xavi Ayén, eso le decidió a tomar la seria determinación de hacerse escritor, y en términos muy similares se expresó en una entrevista con Leandro Pérez Miguel: «Ahí empezó mi vida de escritor, al menos oficialmente. Creo que [Los jefes] es un libro donde se ve una personalidad en proceso de formarse. Los jefes es un pequeño microcosmos de lo que vendrían a ser el resto de mis libros».

Es posible que la primera mención que aparece en prensa de la inminente aparición de este volumen sea la que se publicó en el número 115 de Cuadernos Hispanoamericanos (julio de 1959) del ya mencionado Eduardo Tijeras, que contiene una hoy chocante errata precisamente en el nombre del por entonces autor novel: «El último premio Leopoldo Alas, concedido recientemente al libro Los jefes, de Mariano Vargas, aún no ha visto la luz pública».

badosa

Enrique Badosa.

Sin embargo, los cuentos de ese joven peruano de veintipocos años reunidos en Los jefes están más cerca del estilo que caracterizaba las propuestas de la Editorial Rocas que de los derroteros que iría tomando la narrativa de Vargas Llosa en los años inmediatamente posteriores. Si bien es poco cuestionable el parentesco entre los ambientes, las atmósferas, los personajes e incluso los temas presentes en estos cuentos y los que aparecen en obras como La ciudad y los perros (1963) o Los cachorros (1967), uno de los más perspicaces miembros del jurado que le galardonó, Enrique Badosa, identificó retrospectivamente el que tal vez sea principal rasgo que marca un hiato entre este libro inicial y los posteriores, durante una conversación del autor con varios editores barceloneses en 1967:

En su primera obra, Los jefes […] emplea usted un estilo que se podría denominar convencional; esto es, un estilo en el que, desde fuera de la obra, el narrador describe personajes, hechos y diálogos. En Los cachorros, por el contrario, usted se sitúa, por así decirlo, en el seno mismo de lo relatado, más casi como sujeto paciente de su literatura que como sujeto agente. Por otra parte, en Los jefes la originalidad creadora era buscada, sobre todo, en la novedad del argumento, mientras que en Los cachorros esa originalidad se busca más en el cómo se dice lo que se dice.

Es muy conocido, porque se ha repetido muchas veces, que la sugerencia de presentar su segunda obra a Carlos Barral le llegó a Vargas Llosa en París a través del hispanista Claude Couffon (1926-2013), quien consideraba al por entonces director de Seix Barral el único capaz de conseguir que La ciudad y los perros pasara sin daños excesivos por la censura española, pero en cualquier caso es evidente que, debido a la línea editorial de Rocas, centrada en el cuento realista con un componente de crítica social, la evolución del escritor peruano no hubiera tardado en desentonar en el catálogo de quienes le descubrieron como narrador.

Aun así, el galardón y la publicación a Los jefes, añadida a la de obras primerizas de tantos otros autores que no tardarían en consagrarse mediante premios de mayor relumbrón, son muy indicativos del buen olfato y la intuición del grupo que gestionaba la Editorial Rocas, capitaneado por Enrique Badosa, quien poco después se convertiría en una de las piezas importantes de la editorial Plaza & Janés, sobre todo como director del departamento de Lengua Española y de las colecciones Selecciones de Poesía Española y Selecciones de Poesía Universal.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

El grueso de los autores del boom en Barcelona. Al fondo a la izquierda, al lado de Barral, puede verse a Vargas Llosa.

Fuentes:

Xavi Ayén, «Vargas Llosa: “Barcelona me hizo escritor”», La Vanguardia, 10 de octubre de 2010.

Enrique Badosa, Juan Ramón Masoliver, Joaquín Marco, Esther Tusquets, Carlos Barral y Jose María Castellet, «”Realismo” sin límites. Vargas Llosa, diálogo de amistad», Índice, núm. 224 (octubre de 1967, pp. 21-22. Recogido en Joaquín Marco y Jordi Gracia, eds., La llegada de los bárbaros. La recepción de la narrativa hispnoamericana en España, 1960-1981, Barcelona, Edhasa (El Puente), 2004, pp. 479-484.

Ernesto Mauri, «En recuerdo de Esteban Padrós de Palacios», Luke, núm. 97 (junio de 2008).

Leandro Pérez Miguel, «Mario Vargas Llosa: “Los jefes es un microcosmos del resto de mis libros”», El Mundo, 11 de agosto de 1999.

Eduardo Tijeras, «Noticia sobre el Premio Leopoldo Alas», Cuadernos Hispanoamericanos, núm. 115 (julio 1959), pp. 68-72.

Eduardo Tijeras, «Segunda noticia sobre la colección Leopoldo Alas», Cuadernos Hispanoamericanos, núm. 125 (mayo 1960), pp. 236-238.

Mario Vargas Llosa, «Acerca de mis primeros cuentos», en Lauro Zavala, ed., Teorías del cuento II: La escritura del cuento, México, Universidad Nacional Autónoma de México, Textos de Difusión Cultural. Serie El Estudio, 1995, pp. 207-212.

 

El acto de editar como acto de escritura/lectura. Entrevista a Gustavo Guerrero

Gustavo Guerrero (Caracas, 1957), profesor universitario, crítico literario y ensayista, escritor y consejero literario para el ámbito de la lengua española en Gallimard, desde hace ya varios años ha asistido desde una posición privilegiada a los procesos de internacionalización de la literatura española y latinoamericana, en los que París ha desempeñado un papel fundamental.

expo-sarduyguerrerowal176

Gustavo Guerrero y el editor François Wahl (1925-2014).

Llegas a París, habiéndote graduado en Derecho en la Universidad Andrés Bello, ¿qué te lleva a París?

En realidad, el viaje a París supuso una ruptura. Durante mis últimos años en Caracas vivía una doble vida: de día era un joven abogado especializado en derecho financiero (trabajaba en la colocación de bonos de la deuda pública en los mercados extranjeros) y de noche escribía reseñas y notas bibliográficas para el suplemento literario del periódico El Universal (por entonces uno de los más importantes de Venezuela) y también para otras publicaciones nacionales y extranjeras (entre ellas, la famosa Vuelta de Octavio Paz). Llegó un momento en que se hizo imposible seguir sirviendo a estas dos coronas.

genette

Gérard Genette (París, 1930).

La Fundación para la Cultura y las Artes de Caracas me ofreció una salida al otorgarme una beca de estudios en teoría y crítica literaria sobre la base de un dosier formado por mis artículos. Así salí de Venezuela y del mundo del derecho; así llegué a París y al departamento de teoría literaria de la Escuela de Altos Estudios en Ciencias Sociales. Pero el derecho y las finanzas no desaparecieron del todo. Han sido, por el contrario, dos herramientas esenciales para ejercer cabalmente el oficio de editor.

Cuando entras en la Escuela de Altos Estudios en Ciencias Sociales, Gerard Genette (n. 1930), que dirigió tanto tu licenciatura como tu doctorado, era ya una estrella de los estudios literarios, pero en 1982, justo cuando tú te diplomas, publica un ensayo tan influyente como el Palimpsestos. ¿Qué puedes contar del Genette profesor y de su influencia sobre tu modo de afrontar la literatura? Porque creo que proponía, sobre todo en Figuras III, un método de análisis de textos literarios muy útil y productivo.

Palimpsestos fue primero un seminario de dos o tres años en la Escuela, y luego una lectura capital. ¿Qué decía Genette en ese libro? Afirmaba que el sentido de una obra literaria no dependía de la sola estructura de su texto (algo que en aquel entonces aún parecía bastante herético) sino que variaba en función del entorno de ese texto y, en particular, de la manera como el objeto libro, a través de sus cubiertas, ilustraciones, cuartas de forro, solapas, etc., trataba de inducir o incluso de imponer una cierta interpretación. Para mí fue el descubrimiento de que el acto editorial podía ser un acto de escritura/lectura que implicaba la imposición de un sentido y secretaba (o trataba de secretar) un horizonte de recepción determinado. Editar era algo más que hacer libros; era conferir un sentido, formular una propuesta de lectura.

¿Cuáles eran tus experiencias editoriales cuando llegas a Gallimard?

logoduseuil

Logo de Éditions du Seuil, obra de Robert Lapoujade, que reproduce su sede entre 1945 y 2010: rue Jacob, 27.

Es una historia un poco larga. Antes de entrar a Gallimard, estuve trabajando durante tres años en Editions du Seuil. Allí me inicié en el oficio, junto a Severo Sarduy y a François Wahl. Todo partió de Genette, que también formaba parte del equipo de le Seuil (por entonces dirigía la colección Poétique). Recuerdo que el tema de mi tesina en la Escuela fue el concepto de neobarroco en la obra de Sarduy. Gracias al apoyo de Andrés Sánchez Robayna, ese trabajito universitario, algo retocado, se editó en Barcelona con el título rimbombante de La estrategia neobarroca (1988). Pero antes de que se publicara, Genette se lo envió al propio Sarduy y éste se lo dio a leer a François Wahl, que era como el gran mandarín de toda el área de humanidades y ciencias sociales en la editorial. Ambos me propusieron que leyera y redactara informes para las colecciones de literatura extranjera.

Fueron unos años inolvidables. Se trabajaba muy a gusto, dentro de un clima de efervescencia, camaradería e informalidad. Todavía soplaban los vientos libertarios del mayo francés por los corredores de la casita de la rue Jacob. Cada libro se leía y se discutía con rigor, con apasionamiento, como si todos participaran en una misma aventura literaria, cultural y política. Redactar un informe era como realizar un ejercicio de crítica en el que se daba por sentado que la responsabilidad de un editor no se limitaba a garantizar un nivel de ventas. Había también una responsabilidad intelectual de saber por qué se hacía lo que se hacía, cómo y para quién. En la rue Jacob aprendí así a redactar informes, cuartas de forro y solapas, comunicados de prensa y hasta documentos comerciales; pero sobre todo a Seuil le debo una idea de lo que significa editar.

croixdusud

Un ejemplo de La Croix du Sud de Caillois: Sécheresse, de Graciliano Ramos.

Tu entrada como director del ámbito de la lengua española en Gallimard se produce en 1996 para sustituir a Severo Sarduy (1937-1993). Por la fecha en que se produce esa llegada de Sarduy, probablemente por problemas de salud ya no tendría ocasión de desarrollar grandes proyectos, pero aun así crea la Nouvelle Croix du Sud (1991-1995), que venía a revitalizar la Croix du Sud (1952-1970) iniciada por Roger Callois (1913-1978) a su regreso de Argentina.

A fines de los ochenta, Sarduy estaba ya muy enfermo y le era muy difícil llevar adelante el proyecto. Su idea era sin embargo original: la Nueva Cruz del Sur debía ser como una meta-colección que releyera críticamente, a veinte años de intervalo, la colección de Caillois. Por un lado, Sarduy pretendía poner en tela de juicio el aspecto pedagógico del latinoamericanismo de Caillois (habría que recordar que la colección de Caillois publicaba a la vez ensayos culturales sobre América Latina y novelas que debían ilustrar las realidades del continente); por otro, Sarduy aspiraba a ampliar y a actualizar la percepción que se podía tener de la literatura latinoamericana en Francia en aquel momento, editando autores anteriores o posteriores al boom, como Macedonio Fernández y César Aira, como Leopoldo Marechal y Luis Rafael Sánchez.

En 1990, cuando Sarduy deja le Seuil por Gallimard, me pide que ocupe el lugar de lector principal en su nuevo equipo. Así llego a Gallimard. Mi papel fue, en un comienzo, el del lector que debía ir buscando a los nuevos autores, pero la enfermedad de Sarduy hizo que la gestión del proyecto fuera cada vez más difícil dentro del equipo y que la nueva colección no consiguiera afirmarse como una propuesta viable. Cuando en 1993 muere Sarduy, aún quedan algunos títulos por publicar y hay que ocuparse de ellos. Mi intención era editar esos títulos pendientes y luego marcharme a los Estados Unidos, a seguir una carrera universitaria allí. Ese fue el plan hasta que, en 1996, Antoine Gallimard me encargó la gestión editorial de toda el área iberoamericana en la colección Du Monde Entier.

nouvellecroixdusud

Un ejemplo de la Nouvelle Croix du Sud.

Con antecedentes tan ilustres en el cargo, como Valéry Larbaud, Héctor Bianciotti, Caillois o Sarduy, su legado en Gallimard debía de resultar de entrada un poco intimidatorio o imponía un nivel de exigencia bastante alto en cuanto a la literatura americana en español, ¿no? ¿Qué sesgo nuevo pretendías darle o cuál era tu intención respecto de las letras en lengua española en Gallimard?

Digamos que las cosas se fueron haciendo gradualmente, lo que les quitó peso y presión. Además, no eran ya los mismos tiempos ni los mismos públicos, ni tampoco la misma editorial. El fracaso de la Nueva Cruz del Sur me sirvió para entender que ya no se podía seguir defendiendo el principio de una colección latinoamericana al margen de las colecciones generales de literaturas extranjeras, como Du Monde Entier. Había que partir del fondo excepcional de autores iberoamericanos que teníamos (y tenemos) en esa colección y pensar una política destinada a preservarlo, renovarlo y ampliarlo. Preservarlo significaba entonces (y significa ahora) conservar dentro de la casa a los autores principales del catálogo: Borges, Cortázar, Onetti, Cabrera Infante, Paz, Fuentes, Vargas Llosa… Había que seguir publicando sus obras y garantizarles una presencia continua. Esa fue mi primera línea de trabajo.

Luego, estaba (y está) la segunda: la renovación del fondo a través de nuevas traducciones de algunos clásicos, como Rulfo, por ejemplo, o Josep Pla. Se trataba (se trata) de transformar en ventaja lo que es un problema para el editor de literatura extranjera: el envejecimiento acelerado de las traducciones.

En fin, la tercera línea de mi trabajo editorial fue (y es) la ampliación del fondo con la incorporación de dos tipos de autores: los ya altamente consagrados y canónicos, como Ricardo Piglia, Javier Marías o Sergio Pitol, y las figuras más recientes que son objeto de un cierto consenso crítico, como Yuri Herrera, Hernán Ronsino, Rodrigo Blanco Calderón y Samantha Schweblin, para citar solo a los más recientes.

cailloisocampo

Roger Caillois y Silvina Ocampo (1903-1993).

¿La reivindicación que a menudo se hace de España como puente entre la creación latinoamericana y los mercados europeos, que en relación a lo que conocemos como el boom quizá sea menos controvertido, hasta qué punto se corresponde, históricamente, con la realidad o es una exageración? ¿Cómo ha sido, históricamente, la relación entre los escritores en español y los lectores franceses?

La relación con el público francés es una vieja y buena relación, que se ha ido renovando a través de los años. Los autores de lengua española se traducen, se editan y son muy leídos dentro de un cierto sector del mercado que no se puede comparar con el de los autores anglos, claro, pero que está lejos de ser insignificante.

Sobre el papel de España como puente hacia los mercados europeos y la verdadera historia del boom, habría que matizar mucho e investigar más. Creo que se ha exagerado demasiado. El boom fue un fenómeno complejo y global en el que no hubo un solo actor sino varios. Y el protagonismo entre distintas plazas (Buenos Aires, México, La Habana, Barcelona, Paris) fue compartido. Hoy la situación también se hace cada vez más compleja y global, pues ya España no tiene el monopolio de la venta de los derechos de traducción de autores latinoamericanos, ni París es ya la única vitrina de la literatura mundial. Tanto el capital simbólico como el capital económico están más dispersos y la producción de valor, a nivel global, se ha fragmentado y atomizado. Es más difícil llegar a consensos críticos. Mira, si no, las interminables y dispares listas con que la prensa internacional nos castiga cada fin de año en París, Barcelona, Buenos Aires, Nueva York, México o Madrid.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

De izquierda a derecha: Castellet, García Márquez, Barral, Vargas Llosa, Félix de Azúa, Salvador Clotas, Cortázar y García Hortelano.

En el caso del boom, se asume a menudo que el espacio clave es Barcelona, y la agencia de Carmen Balcells en particular, para su internacionalización. Pero parece lógico pensar que sin traducciones podría haber quedado circunscrito al ámbito hispanohablante, y no fue el caso. ¿Qué pesa más en esa internacionalización, el hecho de que autores como Cortázar residan en París o la existencia de una larga tradición de relaciones entre Latinoamérica y Francia, quizá peor conocida? ¿Qué papel atribuyes en ello a Carmen Balcells?

Carmen Balcells transformó la venta de derechos de traducción en un negocio global. Su modelo fue el del marchant d’art que se implicaba en la vida y la obra de los artistas que representaba y los acompañaba en su aventura creativa. En este sentido, era una mujer notabilísima, que respetaba a sus autores, los conocía y conocía la literatura cuyos derechos de traducción negociaba. Ahora bien, sin el contexto internacional que trajo consigo la Revolución Cubana, sin la potencia y la experiencia del polo editorial de Buenos Aires (ahí estaban Sudamericana, Losada y tantas otras casas), sin las traducciones de la colección de Roger Caillois (que circulaban por toda Europa y llegaban a los Estados Unidos), sin Carlos Barral y sus premios, y en fin… sin tantos otros factores, como el genio de Cortázar, García Márquez y Vargas Llosa, sin todo esto no habría habido ningún boom. Así que no exageremos tanto, por mucho que queramos a Carmen y que nos guste Barcelona.

castelletvalverdepetitbarralvseix

De izquierda a derecha: Castellet, José M. Valverde, Joan Petit, Barral y Víctor Seix.

Lo que sí habría que subrayar es que Carmen, como la mayoría de las agentes españolas, era ante todo una gran lectora de sus autores, los conocía y conocía perfectamente sus obras, y cuando hablaba con un editor extranjero, sabía de qué le estaba hablando y sabían también con quién estaba hablando. Por encima de todo, era una mujer que conocía y amaba la literatura que se escribe en español en las dos orillas de la lengua. No siempre es el caso hoy, ya que la venta de derechos está a veces en manos de agentes que no leen el español ni saben nada de sus literaturas ni se interesan de veras en nuestros escritores; o solo saben hablar de su potencial comercial.

Posteriormente, enterrado ya Franco, París volvió a ser un núcleo de difusión importante en relación a la promoción de escritores españoles como Muñoz Molina (n. 1956), Julio Llamazares (n. 1955), Juan José Millás (n. 1952), Javier Marías (n. 1952), Luis Landero (n. 1948), etc., ¿no?

Rafael Conte (1935-2009).

Es cierto. Allá por los ochenta, cuando trabajaba en le Seuil, la promoción de la nueva ola española fue una de nuestras prioridades. Rafael Conte, amigo de la casa, hizo mucho por ellos. También José Miguel Ullán. Recuerdo el lanzamiento de las novelas de Eduardo Mendoza, o de los libros de la cuentista Cristina Fernández Cubas en París. Fue un gran momento de la narrativa española en Francia. Y creo que tuvo repercusiones en toda Europa, ciertamente.

 

En el caso de la literatura catalana, lo habitual es ampliar los lectores mediante la traducción primero al español, pero no fue ese el caso de Joan Sales y su Incerta glòria, cuya primera traducción fue la de Bernard Lesfargues al francés como Gloire incertaine en 1962 (la española, de Carlos Pujol, tuvo que esperar hasta 1969), pero que gracias a que apareció en una editorial como Gallimard luego fue contratada enseguida en otros países. Hay una vocación explícita, parece, de actuar desde Gallimard como puente entre culturas a través de las traducciones, ¿no es así?

Pascale Casanova habla en su libro La République Mondiale des Lettres (1998) del «efecto París», para referirse al impacto simbólico que supone, a un nivel internacional, la traducción al francés de un autor extranjero. No sé si todavía París tiene esa potestad, pero tradicionalmente las traducciones que publica Gallimard sí han tenido ese efecto canónico, un suplemento evaluativo reconocido por premios internacionales como el Nobel. La correspondencia de Caillois con muchos editores extranjeros constituye un registro de este modo de circulación de las traducciones francesas y de la atención que se les prestaba, que aún se les presta, a nivel internacional.

En la misma colección donde Gallimard sitúa, por ejemplo, las obras de Sándor Márai, Pasternak, Faulkner o Kundera, Du Monde Entier, puede encontrarse el Cahier gris de Josep Pla, Frémisante mémoire de Jesús Moncada, La place du Diamant, de Mercè Rodoreda. Y el tándem Ramón Chao-Serge Mestre ha traducido directamente del gallego varias obras de Manuel Rivas en diversas colecciones de Gallimard, que al parecer han sido en general bien acogidas. ¿Estas obras en otras lenguas peninsulares, llegan a Gallimard a través de traducciones previas al español, o hay una mirada puesta en el canon y las novedades de las literaturas gallega y catalana?

salesgallimard1962Sí se les ha dado una atención especial a las lenguas de la Península. Manuel Rivas se traduce en Gallimard directamente del gallego, como Moncada y Pla del catalán. Desde 1996 he tratado de tener siempre en mi equipo lectores de las diversas lenguas peninsulares y también de portugués, por supuesto. Rivas y Pla, entre otros, han sido acogidos con bastante éxito. De hecho, una de las aventuras editoriales más felices de estos últimos años fue la traducción integral del Quadern Gris, que solo se conocía en francés en una versión fragmentaria y muy reducida. Pla faltaba en el catálogo de Gallimard y traerlo fue como cumplir con una deuda pendiente para con un autor tan excepcional y tan francófilo. Sueño con traducir un día sus libros de vagabundeos gastronómicos.

Hay una impresión bastante generalizada de que en Francia hay un mayor reconocimiento hacia la labor del traductor, ¿responde eso a la realidad y, en tal caso, a qué lo atribuyes? Podría sorprender que en las traducciones francesas suele indicarse en los créditos si la traducción es del español de Chile, de Argentina, de Colombia o de México, ¿cómo encaja eso con la pretendida unidad de la lengua española?

Los traductores franceses han sostenido durante muchos años un largo combate para que se reconozcan sus derechos. Hoy se les tiende a considerar cada vez más como re-escritores y por ende como co-creadores de la obra que traducen. De ahí que su nombre aparezca sistemáticamente junto al del autor en las portadillas y los créditos. Me parece más que justo. Necesario.

También era justo y necesario hacerle un lugar a las variaciones del español y a los diversos españoles americanos. Siempre se indica en la portada, cuando se traduce del español, si procede de México, Cuba, Chile, etc. La lingüística reconoce la importancia de estas modalidades más allá o más acá de la unidad de la lengua, que es sobre todo un asunto político, no literario ni editorial ni científico.

josephinefelliermarcellinkristevabartheswahlsarduy

De izquierda a derecha: Josephine Fellier, Julia Kristeva, Roland Barthes, François Wahl y Severo Sarduy en los tiempos de Tel Quel.

En tanto que editor, no estrictamente como lector, ¿qué editor o editores te parece que por su modo de enfocar el trabajo, su talante o su obra te han servido de modelos o has aprendido de ellos?

Son muchos y es difícil no ser desagradecido e injusto. Ya te hablé de Sarduy y de Wahl. A ambos les debo una cierta fidelidad a las estéticas y al pensamiento de vanguardia. También los Gallimard han sido un modelo por la manera como reparten el peso entre el valor literario y las expectativas económicas: «encuentre usted buenos libros y el servicio comercial encontrará la forma de venderlos», me dijo Antoine Gallimard en nuestra primera entrevista.

Tendría que citar asimismo a Jorge Herralde por razones semejantes: en medio del huracán neoliberal, entre los noventa y dos mil, la literatura siguió siendo un valor en el catálogo de Anagrama y hoy se puede leer en él una propuesta de escritura/lectura arriesgada, influyente y sólida. No debería olvidar tampoco a los dos Manolos de Pre-Textos, Borrás y Ramírez, que desde Valencia nos siguen dando lo mejor de la poesía y el pensamiento contemporáneo contra viento y marea. Se me ocurren tantos otros nombres de colegas y amigos tan notables y tan diferentes, como Pilar Reyes y Jaume Vallcorba, como Joan Tarrida y Juan Casamayor; de todos ellos he aprendido algo en distintos momentos de estos años.

canagrama

De izquierda a derecha: Gustavo Guerrero, Lali Gubern y Jorge Herralde en la Feria de Frankfurt 2012.

Entre las generaciones más recientes, habría que citar a editores latinoamericanos como Leonora Djament de Eterna Cadencia, Eduardo Rabasa de Sexto Piso o Matías Rivas de la Diego Portales, que asocian la publicación de ensayos de humanidades, teoría y ciencias sociales, con literatura de la más alta exigencia. De hecho, algunas de las voces claves entre las nuevas generaciones de narradores y ensayistas han salido de esos catálogos. Acaso el factor común que los une es una apuesta por la innovación en pos de otro equilibrio entre las dos caras del oficio editorial – la comercial y la intelectual – después de unos años en que parecía que el afán de rentabilidad y los grandes conglomerados lo iban a devorar todo.

Algunos críticos literarios y profesores muy vinculados al sector editorial evitan ejercer la crítica literaria cuando esta puede entrar en conflicto con autores representados, editados o incluso con amigos, y de ahí que sólo reseñen obras de autores que, en ese plano y también en el académico, les quedan lejos. Tú, en cambio, tanto en la Nouvelle Revue Française como en Cuadernos Hispanoamericanos o Letras Libres siempre te has ocupado de las novedades de la literatura hispanoamericana, que ha sido también tu campo preferente tanto en la universidad como en el sector editorial. ¿Cómo se lleva esa cuádruple vertiente de escritor, editor, profesor y crítico literario? ¿No se producen ciertas tensiones en el momento de enjuiciar la obra de autores próximos en alguno de esos sentidos?

Tienes toda la razón. Claro que se produce una cierta tensión cuando se ocupan tantos lugares a la vez en el campo literario y hasta puede haber cierto conflicto de intereses. Esto me ha llevado a reducir drásticamente la publicación de reseñas y artículos de crítica en los últimos años, muy a mi pesar porque llegué a la edición a través de la crítica literaria y porque esa vocación primera sigue siendo con la que más me identifico y la que me ha dado más satisfacciones.

Además, el tener que leer continuamente todo lo que se está publicando dentro de área hispánica suele darte una visión bastante privilegiada de lo que se está escribiendo en un momento dado. Si no he descartado del todo seguir haciendo crítica, es porque, como te decía, veo al acto de editar como una continuación o prolongación del gesto crítico por otras vías: es una propuesta de escritura/lectura que, como la de una reseña o un artículo, puede ser más o menos acertada y recibir una acogida favorable o desfavorable. Por eso a veces me permito escribir sobre los autores que edito, en revistas españolas o latinoamericanas y aun ocurre que los incluya en algún curso o seminario universitario. Es otra manera de publicar y de compartir una propuesta de escritura/lectura. También me permito escribir sobre autores a los que no edito por una razón u otra, pero cuyas obras me interesan o entusiasman.

grupoeds

De izquierda a derecha: Elizardo Martinez (Ediciones El Callejón), Gustavo Guerrero, Leonora Djament (Eterna Cadencia), Juan Casamayor (Paginas de Espuma), Antonio José Ponte (El Diario de Cuba) y Eduardo Rabasa (Sexto Piso), en marzo de 2016

Fuentes adicionales:

Catherine Fel, «Entretien avec Gustavo Guerrero, responsable du domain hispanophone chez Gallimard», Bureau International de L´Édition Française, marzo de 2009.

Gustavo Guerrero «Vivimos una tendencia a la novelización», entrevista en vídeo en Casa América, 7 de octubre de 2011.

guerreroanagrama

Libro con el que Gustavo Guerrero obtuvo el Premio Anagrama de Ensayo 2008.

Gustavo Guerrero, «La mediación editorial, la traducción y la difusión de las literaturas latinoamericanas en Francia: el proyecto Medet-Lat France. 1950-2000», conferencia en el Seminario Internacional Redes públicas, relaciones editoriales. Hacia una historia cultural de la edición iberoamericana, 22 de noviembre de 2016.

María Pizarro Prada, «4 preguntas a Gustavo Guerrero», en el blog de Iberoamericana/Vervuert, 5 de noviembre de 2012.

Susana Reinoso, «Gallimard y los lectores», publicado en Ñ, y en Función Lenguaje (sin indicación de fecha).

Web sobre la historia de Gallimard, de la colección Du Monde Entier y web de Éditions du Seuil.

 

La colección Clàssics Moderns y la creación del canon de la literatura universal reciente

En los primeros años de la década de los ochenta del siglo pasado, uno de los cambios que se estaban produciendo en el panorama editorial español era el progresivo crecimiento del público lector en lengua catalana, y, después de un primer momento en que se hubo publicado a los autores importantes en lengua catalana (exiliados y del interior, más o menos canonizados y jóvenes), diversas editoriales dieron respuesta a este crecimiento del número de lectores con estrategias destinadas a poner a disposición de esos lectores unos cánones de la gran literatura universal reciente.

lawrence

Ejemplo de ello es la colección Les Millors Obres de la Literatura Universal (1981-1986), que en el año 1986 se abriría también a obras del siglo XX y que se pudo llevar a cabo gracias en parte a la coincidencia en el tiempo de empresas potentes como Edicions 62 y Enciclopèdia Catalana, que a su vez adquirieron los sellos Proa (que ya antes de la guerra había creado una muy notable pléyade de traducciones de clásicos), La Galera y Pòrtic.

parce

Francesc Parcerisas.

Sólo un poco anterior a la serie Siglo XX de la MOLU es la colección creada en el seno de Edhasa y capitaneada por el entonces joven pero ya laureado poeta y traductor Francesc Parcerisas (n. 1944) Clàssics i Moderns, que en un período muy breve consiguió poner los cimientos de un canon de la literatura universal reciente con un eclecticismo y una amplitud de miras (presencia de literatura fantástica, de novela juvenil, de textos clave de la gran literatura decimonónica, etc.) que hacen que todavía hoy sea difícil ponerle peros a la vigencia del catálogo de Clàssics i Moderns (véase el Apéndice al final). Sobre las intenciones y los modelos escribió un fragmento muy iluminador el propio Parcerisas como apertura a su muy citado artículo «Sobre la traducció catalana d´Una historia de dos ciutats»:

Cuando en el año 1985 empecé a dirigir la colección de traducciones Clàssics Moderns, en la editorial Edhasa, tenía claro que el modelo debía ser un poco ecléctico, para poder publicar en ella autores modernos pero, sobre todo, para poder llenar todas aquellas lagunas de la literatura moderna que los lectores catalanes aún no tenían al alcance. Los modelos de la Biblioteca Popular de L´Avenç, de la Biblioteca Universal, de la Editorial Catalana y de la colección A Tot Vent de Proa eran parte de la historia y del ejemplo, en particular porque la mayoría de colecciones que proliferaron en aquellos años finales del siglo XX estaban mucho más atentas a las novedades y a traducir a los autores contemporáneos que triunfaban en todo el mundo…

Cuando Parcerisas aterrizó en Edhasa, donde desde el primer momento compartió despacho con María Antonia de Miquel (que gestionó algunos derechos que interesaban a Parcerisas), dirigía esa editorial Javier Pérez, pero sin duda el editor de referencia de la casa era el gran Paco Porrúa (descubridor tanto de Cortázar como de García Márquez e introductor en España de la gran novela fantástica y de ciencia ficción moderna), a quien es muy comprensible que le cayera en gracia quien había sido traductor al catalán de El Hòbbit (La Magrana, 1983) y que en esos mismos años traduciría los tres volúmenes de El senyor dels anells (Vicens Vives, 1986-1989).

sranellsvv

A través del jugoso epistolario de Parcerisas con el traductor establecido en Buenos Aires Jordi Arbonés (1929-2001), publicado en Punctum y digno de un comentario más pormenorizado, es posible reconstruir con cierta precisión cómo va creciendo y desarrollándose el catálogo, que se abría con mucha fuerza en los últimos meses de 1985 con tres autores absolutamente indiscutibles y que daban ya medida del rigor y la exigencia estética que guiarían el proyecto: Herman Hesse (Demian, en traducción del poeta Feliu Formosa), Joseph Conrad (La follia d´Almayer, en la traducción del escritor

Antoni López Llausàs.

Antoni López Llausàs.

exiliado en México Josep Carner-Ribalta, que en 1929 había publicado Antoni López Llausàs en la Editorial Catalana) y Virginia Woolf (Orlando, en traducción de Maria Antònia Oliver, quien en 1973 ya había traducido Els anys, para la editorial Nova Terra, y que ese mismo año 1985 obtenía el Premi a la Traducció al Català de la Generalitat de Catalunya). La cuestión no era sólo facilitar el acceso de los lectores catalanes a las grandes obras y autores de los siglos recientes, sino además hacerlo mediante la revisión de las mejores traducciones existentes, caso de haberlas, y sobre todo mediante nuevas traducciones que no estuvieran demasiado apegadas al momento en que se escribían y que, por tanto, pudieran también convertirse en canónicas. Es indudable que los condicionantes de un mercado tan restringido como el catalán influyen en ello, pero resulta asombroso comprobar que la enorme cantidad de esas traducciones encargadas y revisadas por Parcerisas son las mismas que siguen leyéndose más de treinta años después, y lo insólito es que no hayan envejecido más que los originales de los que parten ni delaten el momento en que fueron escritas.

Tras esta tremenda irrupción, Clàssics Moderns empieza a publicar casi un título mensual, de autores además que no estaban libres de derechos, lo que puede dar una cierta medida de las dimensiones de la apuesta que se estaba haciendo por entonces por esta colección. Al margen de una cierta preferencia por la literatura en lengua inglesa (ocho de esos diez títulos) y del hecho de que varios los títulos y autores habían sido ya publicados en español en Sudamericana y Edhasa (Robert Graves, Virginia Woolf, o más adelante Doris Lessing, Graham Greene o Salinger), es notable la coincidencia que sugieren estos títulos en la concepción editorial entre Parcerisas y Porrúa, pues ambos se atreven a situar al lado de clásicos que cuentan con un amplio consenso en las altas esferas académicas (Thomas Mann, Joyce o Hemingway) a otros autores cuya inclusión puede interpretarse –sobre todo en aquellos años– como una reivindicación de su dignidad literaria. Valga como ejemplo el de Ursula K LeGuin (n. 1929), quien en 2016 se convirtió en una de las pocas personas vivas cuya obra ha sido publicada en la célebre colección impulsada por Edmund Wilson (1895-1972) Library of America. Y a ella podrían añadirse los casos de Ray Bradbury (1920-1912; con cuyas Crónicas marcianas había iniciado Porrúa su editorial Minotauro y que al catalán las traduce Quim Monzó), C.S. Lewis(1898-1963; célebre por sus Crónicas de Narnia), el de Isaac Asimov (1919-1992) o el del ya mencionado Tolkien (1892-1973).

tolkiengil-el-pages-de-ham

En octubre de 1986 está fechada una carta de Parcerisas a Arbonès en la que le cuenta que, debido a la avalancha de traducciones que ha recibido, se ve en la necesidad de hacer ciertos reajustes en la programación. Es evidente que el mercado catalán, aun habiendo crecido, no estaba tampoco en aquellos años en condiciones de absorber tal cantidad de gran literatura, y sobre todo en el caso de los autores que todavía no estaban libres de derechos esas contrataciones suponían una inversión que, añadida a las generadas por las traducciones, convenía empezar a amortizar con una cierta celeridad. Por si estas dificultades no bastaran, ese año empezaban a circular los primeros títulos de la MOLU Segle XX, que constituía una dura competencia en un mercado que no daba ya mucho más de sí. Además, gracias a la colaboración de La Caixa, la MOLU podía ofrecer a los traductores unas remuneraciones sensiblemente superiores; tanto es así, que Parcerisas alternó la dirección de Clàssics i Moderns con la traducción para la MOLU de una antologia de Poesia anglesa i nord-americana (1985), y se incluyó también en la MOLU Segle XX la versión que había hecho en 1968 para Edicions 62 de A cadascú el que és seu, de Leonardo Sciascia (1921-1989).

tropiccancer

Sin embargo, ni la cadencia ni la calidad de títulos aparecidos el año siguiente, 1987, se resienten de ello, y es además el momento en que sale a la luz un proyecto largamente deseado tanto por Parcerisas como por Arbonès, la traducción lo más completa posible de la extensa obra narrativa de un autor cuya imagen literaria se había visto sensiblemente distorsionada por sus problemas con la censura, Henry Miller (1891-1980), y a quien ambos consideraban un autor imprescindible en una colección de estas características. Esta operación se abre con El colós del Marussi, con lo cual la pretensión de Arbonès de completar la Trilogía Rosada queda de momento aparcada. Junto a Miller, es notable el empeño de dar a conocer a un escritor con fama de difícil como Nabokov, de quien ese año se publica L´encantador y Lolita, junto  a un surtido de grandes autores que van equilibrando la panorámica de otras literaturas y géneros, pues si bien aparece un Scott Fitzgerald traducido por Nuria Arqués, se publican también obras de Dostoyevski, Dylan Thomas o, de nuevo, Herman Hesse.

lolita

En el verano de 1987, Parcerisas hace un primer breve balance de Clàssics i Moderns en una interesante carta a quien sin duda se había convertido en uno de sus traductores más fiables, fieles y comprometidos con la colección:

…tenemos todavía un montón de traducciones paradas y, como siempre, lucho entre encargar aquello que creo importante –y necesario– y que me hace ilusión ver publicado, y aquello que sé que tendrá que pasarse meses en el limbo de los cajones. De todos modos, la colección no va mal y la editorial parece bastante contenta. No es de ningún modo algo espectacular desde el punto de vista económico, pero tampoco deben de perder dinero, cosa que, hoy por hoy, ya es bastante notable.

Lo demostraría por ejemplo, que 1988 es el año en que se publican más títulos (trece), y entre ellos unos Dublineses de Joyce, traducidos por el especialista en tan peliaguda tarea Joaquim Mallafré (n. 1941), la traducción del Retrat de l´artista adolescent, del mismo autor, en la versión que Maria Teresa Vernet (1907-1974) había preparado originalmente para Isard, la colección que dirigía Josep M. Boix Selva en Vergara (1967), la que hizo Estanislau Vidal-Folch (hermano de Ignacio) de Viatge al fons de la nit o la que Helena Valenti (1940-1990) llevó a cabo de El factor humà, de Graham Greene.

maantonia

María Antonia de Miquel.

En 1989 la producción vuelve a descender a ocho títulos (entre ellos A repèl, de Huysmans, traducido por el poeta Miquel Martí Pol, dos de Gerard Durrell y Un niu de tórtores, de Katherine Mansfield), pero 1990 es el año en que aparecen más títulos en Clàssics Moderns, quince, quizás en parte debido a que ese año empieza a ser mayor la presencia de autores libres de derechos (D´Annunzio, Stevenson, dos libros de Baudelaire, otros dos de D.H. Lawrence…), lo cual, del mismo modo que el cambio de encuadernación de tapa dura a rústica con solapas, permitía reducir significativamente costes. No obstante eso, la calidad en la selección de títulos y de las traducciones que van apareciendo a partir de ese momento sigue siendo altísima, aun cuando desde ese otoño Parcerisas empieza a dirigir la colección y a mantener el contacto con los colaboradores desde Londres, por lo que Maria Antònia de Miquel se convierte entonces en un enlace importante en el día a día.

98b8d-joseppalauifabre

Josep Palau i Fabre (1917-2008)

Ese año empieza a tomar cuerpo la idea de reunir la obra principal de Henry Miller, aparece la traducción de Mallafré del Ulises, la de Jordi Sarsanedas de Franny y Zoey de Salinger, la de Xavier Benguerel de Les flors del mal, la de Jordi Ibáñez de L´origen d´una insinuació, de Thomas Bernhard, otros dos títulos de André Gide… Y al siguiente (1991), la traducción y edición de Josep Palau i Fabre de las Iluminacions i Una temporada a l´infern de Rimbaud, un Jacques el fatalista i el seu amo traducido por Joan Tarrida, los Petits poemes en prosa de Baudelaire en versión de Joaquim Sala-Sanahuja… y así hasta un total de once títulos que poco a poco van equilibrando la presencia de literaturas como la francesa y la alemana, pese a mantenerse el predominio de la escrita en lengua inglesa.

Escribe a su privilegiado corresponsal Parcerisas el 30 de octubre de 1991:

Ahora empiezo a estar contento con la colección: tenemos cincuenta títulos a nuestras espaldas y no me arrepiento de haber editado ninguno de ellos. Si acaso, algunos que yo no hubiera publicado son de los que mejor se venden, pero, de entre los que no se venden, no renuncio a ninguno. Hemos conseguido un cierto prestigio y sólo debemos no bajar la guardia: mantener buenos autores, buenas traducciones y buen diseño. El resto son cabòries.

Si, con esto, algún día se cierra el grifo, como mínimo podemos estar orgullosos de la labor llevada a cabo. De momento, Edhasa, con todo, quizá no ganan dinero, con el catalán, pero tampoco creo que lo pierdan.

ulisesEs muy sorprendente, e indicativo de hasta qué punto en Edhasa los directores de colección trabajaban en buena medida a ciegas respecto al rendimiento comercial de los títulos, sin acceso a los números, que sólo tres semanas después Parcerisas informe a Arbonès de que «es inminente una cierta restricción en nuestras traducciones […] tengo una traducción [de Les bostonianes, de Henry James] que duerme sobre mi mesa que ahora no sé si podremos publicar».

Es muy probable que el motivo sea que en esas fechas, aprovechando la Feria de Frankfurt, los propietarios de Edhasa viajaban a Barcelona y era cuando los editores y directores de colección conocían realmente cómo andaban las cosas en este aspecto. Ciertamente, un simple vistazo al apéndice permite advertir hasta qué punto disminuyó la producción en los años siguientes (seis en 1992, tres en 1993, uno sólo en 1994), antes de que la colección fuera adquirida por Enciclopèdia Catalana, y continuada, con otra dirección, en Proa. Pero aun así hubo tiempo de recuperar por ejemplo la traducción de Josep Ros i Artigas (1907-1998) de Torrents de primavera, que se cuenta entre las primeras de una obra de Hemingway (publicada en los Quaderns Literaris de Janes en 1937) que el propio traductor tuvo aún tiempo de revisar, o Un hivern a Mallorca, de George Sand, en traducción de Marta Bes i Oliva, prologada por el poeta y narrador Antoni Marí y completada con un apéndice obra del ilustre mallorquín de adopción Robert Graves (1895-1985).

La situación económica y de gestión desembocó en la sustitución de Javier Pérez por Jordi Nadal, y la severa reducción de las ediciones en catalán que siguieron, la marcha de Paco Porrúa y su Minotauro, las salidas en poco tiempo de María Antonia de Miquel, Raquel Fosalba, Toni Estela, Joan Roig, así como el absorbente trabajo en la Universitat Autònoma de Barcelona fueron motivos más que suficientes para que en la primavera de 1993 Parcerisas acabara por dejar Edhasa, pero, como bien dijo, a la vista del catálogo de Clàssics Moderns, podía estar orgulloso de la labor llevada a cabo.

parce2

Francesc Parcerisas.

Apéndice: Obras publicadas en Clàssics Moderns Edhasa.

Hermann Hesse, Demian, traducción de Feliu Formosa, 1985.

Joseph Conrad, La follia d´Almayer, traducción de Josep Carner-Ribalta, 1985.

Virginia Woolf, Orlando. Una biografia, traducción de Maria Antònia Oliver, 1985.

androides-previewUrsula K. Le Guin, La costa més llunyana, traducción de Madeleine Casas, 1986. (núm 3)

Ray Bradbury, Farenheit 451, traducción de Jaume Subirana, 1986.

Ursula K. Le Guin, Un mag de Terramar, traducción de Madeleine Cases, 1986.

Sylvia Plath, La campana de vidre, traducción de Josep Miquel Sobrer, 1986.

Robert Graves, Jo, Claudi, traducció d´Helena Valentí, 1986.

Hermann Hesse, Siddhartha, una composició india, traducción de Carme Gala, 1986.

Laurie Lee, Sidra amb la Rosie, traducción de Montserrat Solanas, 1986.

Ursula K. Le Guin, Les Tombes d´Atuan, traducción de Madeleine Cases, 1986.

Aubrey Beardsley, Relació de Venus i Tannhauser, prólogo de Joan Perucho, traducción de Corvo & Myer, 1986.

Marguerite Duras, Moderato cantábile, traducción de Joan Cases, 1986.

captenemicHenry Miller, El colós de Marussi, traducción de Jordi Arbonès, 1987.

Ray Bradbury, Les cròniques marcianes, traducción de Quim Monzó, 1987.

Francis Scott Fitzgerald, El diamant gros com el Ritz, traducción de Neus Arqués, 1987. (contes)

Doris Lessing, La terrorista bona, traducción de Ramon Barnils y Francesc Parcerisas, 1987.

Vladimir Nabokov, L´encantador, prólogo del autor, epílogo de Dmitri Nabokov, traducción de Jordi Arbonès, 1987.

Fiodor M. Dostoievski, Dimonis, traducción de Josep M. Güell, 1987.

Hermann Hesse, El llop estepari, traducció de Margarida Sugranyes, 1987.

Vladimir Nabokov, Lolita, traducción de Josep Daurella, 1987.

Dylan Thomas, Sota el bosc lacti, drama per a veus, traducción de Angela Suxton y Salvador Oliva, 1987.

James Joyce, Dublinesos, traducción de Joaquim Mallafrè, 1988.

fillahomerM. Cotzee, Esperant els bàrbars, traducción de Xavier Rello Andreu, 1988.

Roberts Graves, La filla d´Homer, traducción de Isabel Turull, 1988.

Gerard Durrell, Ocells, bèsties i parents, traducción de Josep Julià, 1988.

Mervyn Peake, El Castell de Gormenghast, traducción de Josep Miquel Sobrer, 1988.

Jane Austen, Persuasió, traducción de Jordi Arbonès, 1988.

James Joyce, Retrat de l´artista adolescent, traducción de Maria Teresa Vernet, 1988.

Virginia Woolf, Els anys, traducción de Maria Antonia Oliver, 1988.

Louis-Ferdinand Céline, Viatge al fons de la nit, traducción de Estanislau Vidal-Folch, 1988.

Graham Greene, El factor humà, traducción de Helena Valentí, 1988.

R. R. Tolkien, El Ferrer de Wootton Major; “La Fulla” d´en Niggle, traducción de Jordi Arbonès, 1988.

els-anysMervyn Peake, L´hereu de Gormenghast, traducción de Josep Miquel Sobrer, 1988.

R. R. Tolkien, Gil, el pagès de Ham, traducción de Carlos Llorach, ilustraciones de Pilar Baynes, 1988.

Huymans, A repèl, traducción de Miquel Martí i Pol, 1989.

Graham Greene, El capità i l´enemic, traducción de Xavier Rello Andreu, 1989.

Katherine Mansfield, Un niu de tórtores, Josep Julià, 1989.

Virginia Woolf, Les ones, traducción de Maria Antonia Oliver, 1989.

Thomas Mann, Els caps bescanviats, traducción de Margarida Sugranyes, 1989.

Gerard Durrell, El Jardí dels Déus, traducción de Jordi Arbonès, 1989.

Gerard Durrell, Filets de palaia, traducción de Josep Julià, 1989.

K. Narayan, En Swami i els seus amics, traducción de Ramon Barnils, 1989.

D. Salinger, Franny i Zoey, prólogo y traducción de Jordi Sarsanedas, 1990.

D.H. Lawrence, La Guineu i altres relats, traducción de Josep Julià i Marta Bes, 1990.

Gabriele D´Annunzio, La Leda sense cigne, El company d´ulls sense pestanyes, traducción de Jordi Cornudella, 1990.

Katherine Mansfield, Una mica infantil, traducción de Josep Julià, 1990.

André Gide, L´Immoralista, traducción de Marta Bes i Oliva, 1990.

D.H. Lawrence, Dones enamorades, traducción de Jordi Arbonès, 1990.

Kenneth Grahame, El vent entre els salzes, traducción de Jordi Arbonès, 1990.

Thomas Bernhard, L´origen d´una insinuació, traducción de Jordi Ibáñez, 1990.

Benguerel

Xavier Benguerel.

Charles Baudelaire, Els paradisos artificials, traducción de Carles Castellanos, 1990.

Charles Baudelaire, Les flors del mal, traducción de Xavier Benguerel, 1990.

André Gide, La porta estreta, traducción de Marta Bes i Oliva, 1990.

Roberts Louis Stevenson, Marea minvant, traducción de Judith Willis y Toni Turull, 1990.

James Joyce, Ulises, traducción de Joaquim Mallafrè, 1990.

Henry Miller, Tròpic de Càncer, traducción de Jordi Arbonès, 1990.

Sommerset Maugham, Els Mars del Sud, traducción de Lluis Canyadas, 1990.

Arthur Rimbau, Il·luminacions. Una temporada a l´infern, versión, introducción y notas de Jaume Palau i Fabre, 1991.

S. Lewis, El nebot del mag, traducción de Jordi Arbonès, 1991.

S. Lewis, El lleó, la bruixa i l´armari, traducción de Jordi Arbonès, 1991.

Gerard Durrell, L´excursió i d´altres maremàgnums, traducción de Jordi Arbonès, 1991.

Chales Baudelaire, Petits poemes en prosa, prólogo y traducción de Joaquim Sala-Sanahuja, 1991.

Jane Austen, L´abadia de Northanger, traducción de Jordi Arbonès, 1991.

Denis Diderot, Jacques el fatalista i el seu amo, traducción de Joan Tarrida, 1991.

Horst Bienek, La primera polca, traducción de Carme Gala, 1991.

Charles Dickens, Una historia de dues ciutats, traducción de Jordi Arbonès, 1991.

R. R. Tolkien, Silmaríl·lion, traducción de Dolors Udina, 1991.

Richard Adams, El turó de Watership, traducció de Montserrat Solana i Mata, 1991.

S. Lewis, El cavall i el seu noi, traducción de Jordi Arbonés, 1992.

Fulco di Verdura, Una infancia siciliana. Els dies feliços d´estiu, traducción de Caterina Molina, 1992.

George Sand, Un hivern a Mallorca, prólogo de Antoni Marí, apéndice de Robert Graves, traducción de Marta Bes Oliva, 1992.

Giacomo Joyce, James Joyce, introducción y notas de Richard Ellmann, traducción de Joaquim Mallafrè, 1992.

Isaac Asimov, La segona fundació, traducción de Sílvia Aymerich, 1992.

hemingwayperkins

Hemingway con, a su izquierda, el editor Maxwell Perkins.

Ernst Hemingway, Torrents de primavera, novel·la romantic en honor d´una gran raça en extinció, traducció de Josep Ros-Artigues, 1992.

Ursula K. Le Guin, Tehanu. L´ultim llibre de Terramar, traducción de Madeleine Cases, 1993.

Gerard Durrell, Amb un zoo a les maletes, traducción de Josep Sala Barbany, 1993.

Philip K. Dick, Els androids somien xais electrics. Blade Runner, traducció de Manuel de Seabra, 1993.

R. R. Tolkien, Contes inacabats de Númenor i Terra Mitja, introducción, comentarios, índice y mapas de Christopher Tolkien, 1994.

Fuentes:

Sam Abrams, «Francesc Parcerisas, traductor», Caràcters, núm. 10 (enero de 2000), pp. 7-8.

aarbones-parcerisas-180x276Jordi Arbonès y Francesc Parcerisas, Epistolari, edición al cuidado de Jordi Mas López, Lleida, Punctum (Visions 6), 2016.

Anónimo, «Edhasa reorganiza su plantilla y reduce novedades como reacción a la crisis», El País, 22 de enero de 1993.

Francesc Parcerisas, «Sobre la traducció catalana d´Una historia de dos ciutats», L´Avenç, núm. 411 (abril de 2015), p. 9; recogido en los anejos del epistolario de Parcerisas con Arbonès ya citado, pp. 259-276.

Rosa Maria Piñol, «Edhasa enceta una nova col·lecció de narrativa estrangera en català», La Vanguardia, 24 de diciembre de 1985.

Sobre Jordi Arbonès, véase el portal de la Càtedra Jordi Arbonès, de la Universitat Autònoma de Barcelona.

Y el testimonio oral, que agradezco muchísimo, de Esther López, María Antonia de Miquel y Pablo Somarriba.

Reconstruir la historia de la editorial Afrodisio Aguado a ciegas

En el libro que, con motivo de sus primeros cincuenta años, resume la historia de la editorial Taurus, el teólogo y académico Olegario González de Cardedal (n. 1934) subraya la importancia de la editorial de Afrodisio Aguado en las primeras décadas de la posguerra española, en particular en la formación de editores y libreros, pero apunta un buen propósito que no parece que hasta el momento de escribir estas líneas, doce años después de expresado, lleve trazas de verse cumplido:

[La editorial Afrodisio Aguado] ha sido decisiva en la cultura española en los decenios 1940-1960, ya que no sólo editó las Obras completas de Bécquer, Unamuno y Rubén Darío, sino que allí se forjaron libreros que luego serían editores como Marcial Pons y Manuel Sanmiguel, creador primero de Guadarrama y luego de Cristiandad, editorial que tras su muerte subsiste en otras manos hasta hoy. Afrodisio Aguado fue una editorial sorprendente que en la posguerra intentaba sobrevivir como empresa familiar […] De Carmina Aguado, hija del fundador, recibo no sólo información minuciosa sino numerosos libros, que ella guardaba como legado de amor recibido de su padre. Algún día espero poder contar su historia completa.

Lamentablemente, tampoco en el portal EDI-RED figura de momento ninguna información sobre esta editorial, por lo que el único modo de acercarse un poco a ella es espigar algunos datos muy dispersos, inconexos e incluso en algunos casos en apariencia contradictorios.

aguado

Ya en los años diez del siglo XX la empresa de Afrodisio Aguado Ibáñez, con sede en el número 130 de la calle Mayor, era la más importante de la ciudad de Palencia en los ámbitos de la encuadernación y la venta de libros, y en 1919 compró dos Minerva y amplió su radio de acción a la tipografía y la impresión. En 1921, por ejemplo, está fechada una Pedagogía musical de Gonzalo Castrillo con un pie que indica Litografía Librería Afrodisio Aguado, y con el subtítulo «Conferencia sobre el canto popular religioso y su desarrollo en la iglesia española, con ejemplos prácticos», que tuvo como escenario el Teatro Principal de Palencia el 6 de junio de ese año 1921.

También de ese año parece el volumen conmemorativo y ampliamente ilustrado Libro del VI Centenario de la S. I. Catedral de Palencia, según se incica, «publicado por la comisión organizadora en Imprenta y Librería de Afrodisio Aguado». Ese nombre, «Imprenta y Librería Afrodisio Aguado», es el que figura en el pie de imprenta de algunos otros modestos libros de los años veinte, como en la Historia de Palencia vista a través de las gafas de Siro de Gandía (1926), de Emilia Pita Do Rego, y en la Geografía de Palencia (1928) de Sebastián González. En aquellos tiempos el negocio ya estaba tomando unas dimensiones considerables, pues en 1926 contaba con cinco empleados: Jesús Hernández, Félix Calvo, Dámaso Aguado Ibáñez, Gaudencio Caro y Casilda Ibáñez. A partir de 1929 y hasta 1932 se ocuparon también de la impresión de la revista decenal La Escuela.

anunciaguado

El carácter local y musical de estas primeras impresiones toman un sesgo muy distinto con la entrada en la década de 1930, en que se convierte en la imprenta de la revista dirigida por Andrés Redondo (hermano del falangista Onésimo) Igualdad y, de apariencia gráfica muy similar, del semanario vallisoletano Libertad, dirigido por Onésimo Redondo (1905-1963), quien por entonces estaba creando la agrupación fascista Juntas Castellanas de Actuación Hispánica (que ese mismo año se integrarían en la Juntas de Ofensiva Nacional-Sindicalista, las JONS). En 1934 Afrodisio Aguado, cuya empresa empezaba a tomar impulso, estableció en el número 13 de la calle San Martín de Valladolid una imprenta y librería, y ese mismo año Hacienda estimaba el valor de la maquinaria de que disponía Afrodisio Aguado en nada menos que 30.000 pesetas y además había incorporado a Vidal Fernández (contable) y a los dependientes Moisés Martín, Francisco Abril y Gerardo del Campo.

De esas mismas fechas más o menos debe de ser el libro sin indicación de año sobre la Juventud Obrera Cristiana Qué es la J.O.C., y de 1933 el destinado al público juvenil Mi primer libro de historia, de Daniel González Linacero, al que seguiría el año siguiente Mi segundo libro de historia, del mismo autor. Sin embargo, ya se publica con pie en Valladolid-Palencia, aunque sin fecha, Falange Española. Textos fundamentales y, en Valladolid y bajo el membrete de Ediciones Libertad, Doctrina de F.E. de las JONS, ambas como impresas en Artes Gráficas Afrodisio Aguado. Es probable que algunos de estos libros sin fecha aparecieran ya durante la guerra civil, como es el caso de otros títulos de esas Ediciones Libertad, como 1931-1936, Sindicatos y agitadores nacional sindicalistas, del sindicalista de la JONS Emilio Gutiérrez Palma, la biografía Onésimo Redondo, caudillo de Castilla, anónima, que indica en el colofón el 26 de febrero de 1937 como fecha de salida de los «Talleres Tipográficos de Afrodisio Aguado, en Valladolid». También de la vallisoletana Imprenta Afrodisio Aguado salió en 1938 una de las muchas ediciones del volumen de Redondo El Estado Nacional.

cartelaguado

Otro cartel impreso en Afrodisio Aguado durante la guerra.

Según registraba el Diario Palentino en su sección de «Recuerdos viejos/Palencia hace…» acerca de las noticias más importantes del 31 de agosto, una vez ya iniciada la guerra:

El Instituto Nacional de Previsión pidió a la Diputación palentina unos locales para instalar una clínica de obstreticia. La Corporación Provincial respondió que iba a estudiar esa petición con el mayor interés y trataría de cumplirla satisfactoriamente. Los concejales falangistas Afrodisio Aguado, Alejando Font de Bedoya y Manuel Santamarina presentaron la renuncia de sus cargos municipales, en acatamiento a la disciplina del partido. Empezaban a recibirse cartas de voluntarios y soldados solicitando madrinas de guerra.

Durante la contienda, aparecen con pie de Afrodisio Aguado algunos otros libros de título inequívoco, como Desde el Cuartel General de Miaja al Santuario de la Virgen de la Cabeza. 30 días con los rojos separatistas sirviendo a España. Relato de un protagonista (1937), del capitán Antonio Reparaz Araujo y Tresgallo de Souza, Defensa de Oviedo (1937), del también capitán Óscar Pérez Solís, con prólogo del general Antonio Aranda e ilustraciones fotográficas fuera de texto, así como algunos carteles (uno del Auxilio Social, obra de Carlos Sáenz de Tejada; «La Falange os llama. Ahora o nunca», firmado «V. Fito»), y de fechas no muy posteriores son dos libros de Javier Martínez de Bedoya (que era uno de los empleados de Aguado): Antes que nada, política (1939) y Siete años de lucha. Una generación política, en la que compendia artículos aparecidos previamente en la revista JONS y otros publicados durante la guerra en los que justifica la violencia como el único método de acabar con la burguesía democrática y con el marxismo.

calendario46aguado

Página del calendario Aguado de 1946.

Concluida la guerra civil, Afrodisio Aguado se traslada a Madrid, donde abre una librería que no tarda en convertirse en una de las más importantes de la ciudad, y en que se foguean en el mundo de los libros Carmen Abril, Marcial Pons, Alfonso Mangada (que de muy joven fue el gerente y luego crearía Editorial Paraninfo), Manuel Sanmiguel (ya mencionado como fundador Editorial Guadarrama), antes de crear también las Ediciones Afrodisio Aguado (en el número 4 de la calle Barquillo), con talleres propios (en Bravo Murillo, 31). En estas empresas se formaron entre otros el pintor Alejandro Mieres Bustillo (Palencia, 1927), que se inició como dibujante y retocador de originales en los talleres de fotograbados, antes de ingresar en la Escuela de Bellas Artes de San Fernando.

Además de dedicarse al libro escolar, partir de octubre de 1942 Afrodisio Aguado se convierte en impresor El Español. Semanario de la Política y del Espíritu, dependiente de la Delegación Nacional de Prensa. Y a esos años pertenecen también las colecciones que permiten a Xavier Moret señalar Afrodisio Aguado como una de las escasas editoriales que en la inmediata posguerra se abrieron a los autores jóvenes, en particular en la serie Literatura de la colección Cuatro Vientos, cuyo nombre parece evocar la revista y colección del grupo formado en la preguerra por Pedro Salinas, Dámaso Alonso y Jorge Guillén. En esta serie de Afrodisio Aguado aparecieron por ejemplo, sobre todo a partir de 1944 y junto varias piezas teatrales de Shakespeare y reediciones de varias obras de Concha Espina (Altar camilojoseMayor, El cáliz rojo, princesas del martirio), la versión definitiva de la novela de Ramón Ledesma Miranda (1901-1963) Almudena o historias de viejos personajes (1944), que revisaba y aumentaba la que con el título Viejos personajes le había publicado previamente la Agencia General de Librerías y Artes Gráficas e incorporaba además dieciocho ilustraciones de Eduardo Vicente; Zarabanda (1944), de Darío Fernández Florez (1909-1977); La canción del jilguero (1947), de José Antonio Jiménez Arnau (1912-1985), así como el poemario de Emilio Carrere Canciones para ellas (1944), pero sin duda el autor más pujante incorporado a esta colección es Camilo José Cela y su Pabellón de reposo (1944), ilustrada con dibujos de Lorenzo Goñi (que firma como Suárez del Árbol). Curiosamente, en las páginas finales de Nuevas andanzas y desventuras de Lazarillo de Tormes (Ediciones La Nave, 1944) se anunciaba otra obra de próxima aparición en Afrodisio Aguado, el libro de relatos Lo que quedó cuando el amor ya muerto…, que nunca llegó a publicarse con ese título. En cambio, sí aparece Cela en otra edición de Afrodisio Aguado, la novela colectiva publicada al margen de esta colección, Nueve millones (también de 1944), en la que participaron dieciocho escritores (Concha Espina, Emilio Carrere,Carmen de Icaza, Luis Astrana Marín, Benjamín Jarnés, Eduardo Zamacois, Pedro Mata, Fernández Flórez…). Se trata de una edición en rústica, acompañada de fotografías de cada uno de los autores, destinada además, en adaptación de Fernando Garzón, a la radiodifusión por parte del cuadro de actores de Radio Madrid.

Aun así, esta veta de la narrativa en general pronto se vio desplazada en Afrodisio Aguado por las obras clásicas (en colecciones como la célebre Más Allá), las guias de viaje (de las que era pionero) y por el ensayo, así que fueron otras editoriales las que al concluir esa década tomaron el relevo. Sin embargo, habrá que esperar los frutos del anunciado análisis de Olegario González de Cardedal (o bien a que ponga esos materiales que posee a disposición de los investigadores; por ejemplo, a través de EDI-RED) para tener una idea más completa de esa editorial «decisiva en la cultura española en los decenios 1940-1960».

aunpomboangulo

Una edición de los años cincuenta de Afrodisio Aguado.

 

Fuentes:

Olegario González de Cardedal, «Un capítulo de la teología en España», en Taurus, cincuenta años de una editorial (1954-2004), Madrid, Santillana, 2004 (edición no venal), pp. 107-198.

Xavier Moret, Tiempo de editores. Historia de la edición en España, 1939-1975, Barcelona, Destino (Imago Mundi 19), 2002.

José Vidal Pelaz López, «Catálogo de publicaciones periódicas de la provincia de Palencia, 1898-1936», Investigaciones históricas: Época moderna y contemporánea, núm 11 (1991), pp. 229-250.

Josep Salvador, linotipista y editor en Toulouse

A Adrià Pujol Cruells, escriptor empordanès

Al término de la guerra civil española y hasta la liberación de Francia, Toulouse se convirtió en uno de los más interesantes centros editoriales en lengua española, si bien el traslado progresivo de muchos escritores e intelectuales a París hizo que esta condición quedara luego debilitada. Aun así, la vitalidad cultural de los centros de refugiados, a menudo de marcado cariz anarquista, duró aún varias décadas. En Cataluña, por ejemplo, en la inmediata posguerra fue posible sintonizar Radio Toulouse y tener oportunidad de escuchar las emisiones que durante tres meses hizo en catalán el luego importante librero y editor Antonio Soriano (1913-200), que luego regentaría la célebre Librería Española de París.

libesppar

Fue precisamente Soriano quien, con la colaboración de Josep Salvador Puignau (1908-1974)m creó en Toulouse el Centro de Estudios Económicos Toulouse-Barcelona, que José-Luis Morro Casas ha descrito como: «Una especie de Ateneo en el que se realizaban conferencias, cuyo éxito fue tal que la gente casi vivía pendiente de las mismas. Allí hablaron hispanistas como [Jean] Cassou, Henri Lefevre, Bruinstard..», y prosigue más adelante:

A Soriano se le ocurre crear una librería. Le venían a la memoria aquellos años en que fue bibliotecario en Barcelona; volvía a tener la oportunidad de encontrarse con lo que le fascinaba, la obra impresa. Junto a su amigo José Salvador, funda la Librería Española, ubicada en la rue D’Arcole número 1. No sin problemas lograron que un amigo ciudadano francés de origen español, Luis Surères, gestor de profesión, se prestara a regentarla. […] Soriano encontró el filón; con una maleta llena de libros franceses se encaminó hacia Andorra, donde aún quedaban remanentes de libros españoles anteriores a la guerra civil y logró cambiarlos por libros sobre la Civilización Española del Instituto Gallach, que se encontraban a miles. A la vuelta los vendieron enseguida, no quedando más remedio que hacer varios viajes a Andorra por semana.

Cuando Soriano se marchó a París, quedo al frente de la librería en Toulouse Josep Salvador, quien a los dieciocho años se había trasladado de su Palafrugell natal a Barcelona, desde donde se trasladó luego a París para formarse en artes gráficas durante la dictadura de Primo de Rivera. Además de aprender el francés, en esta etapa aprende también esperanto, y a su regreso imparte clases de esta lengua en el Ateneu Enciclopèdic Popular de la barcelonesa calle del Carme. En 1935 crea con un socio una imprenta en la calle Aribau de la misma ciudad, donde trabajará hasta su intervención en la batalla del Ebro y su posterior exilio a Francia en febrero de 1939.

barcares

Campo de concentración en Barcarès.

Tras su paso por los campos de concentración en las playas de Argelés y Barcarès, es enrolado en una compañía de trabajo e inicia entonces un periplo por diversos grupos de trabajadores españoles. Según explica Javier Campillo Galmés en el magnífico estudio que dedicó a Salvador: «El 25 de septiembre de 1944, un mes después de la liberación de Toulouse, Salvador es dispensado de su pertenencia al Grupo 562 de Trabajadores Extranjeros. Salvador adquiere el estatuto de refugiado apátrida, dependiendo del Ministerio de Exteriores francés». Y es un par de años después, en agosto de 1946, cuando inicia trámites para crear en la Librairie des Éditions Espagnoles, mediante la creación de una sociedad en la que inicialmente participaban también Soriano, Solères, Fernand Vargas y Amadeo Vives. Siguiendo de nuevo a Campillo Galmés:

Un recorte de prensa de la época recoge los dos objetivos de la librería: por una parte, favorecer la difusión de las publicaciones españolas entre el público francés y, por otra, ayudar a los intelectuales españoles mediante la edición de sus obras. Se dice incluso que «cuando España sea libre, una casa análoga se abrirá más allá de los Pirineos, lo que contribuirá a un activo intercambio cultural entre nuestros dos países»

arguellesexpo1947

Diseño de ArgÑuelles para una exposición en Toulouse en 1947.

La edición pues de libros, asumida por Soriano y Salvador como un deber moral, se inicia en 1947 con la publicación en el sello Librairie des Editions Espagnoles de Tres mesos i un dia a Nova York, de Josep Mª Poblet (1897-1980), Goya: sa vie, son ouevre, son temps…, de Domènec de Bellmunt (1903-1993), con una serie de muy famosos Boletines Bibliográficos (preciada compilación de libros publicados en español) y la muy celebrada colección La Novela Española, quizás la mayor contribución de la LEE a la edición en lengua española, a la que en 1948 se añade una colección dirigida por el hispanista Pierre Darmangeat dedicada a los clásicos españoles (Tirso, Garcilaso, Zorrilla, etc.), todas ellas impresas en Toulouse. Poco después se empiezan a imprimir también en París, es de suponer que bajo la supervisión de Soriano, que ya se había establecido allí, con indicación editorial «París-Toulouse: Librairie des Éditions Espagnoles». Las primeras obras son tres conferencias de peso: La lengua y la cultura en Hispanoamérica (1951), de Ángel Rosenblat, El sentido del Lazarillo de Tormes (1954) de Marcel Bataillon y El romanticismo y el siglo XX (1955) de Pedro Salinas.

tirso

La famosa colección La Novela Española la dirigía inicialmente el excolaborador de La Revista Blanca, Umbral y, ya en Francia, el parisino El Heraldo de España Antonio Fernández Escobés, y la constituían pequeños volúmenes de 16 x 12 de entre treinta y cuarenta páginas en las que el texto de relatos y novelas breves aparecían compaginados a doble columna y con portadas diseñadas y dibujadas por el cartelista Antonio Argüello. A la muerte de Fernández Escobés le sustituyó en la dirección Ezequiel Endériz. Tras estrenarse con la cervantina Rinconete y Cortadillo, entre 1947 y 1949 La Novela Española publicó mensualmente una amplia combinación de clásicos indiscutibles (para cumplir con el propósito de dar a conocer la cultura española en el país de acogida) con novelas breves de autores exiliados (a los que se pretendía ayudar en alguna medida). Así, junto a obras de Lope de Vega o Quevedo, aparecen antologías poéticas de Federico García Lorca y Machado y obras de Alejandro Casona, Victor Alba y Ramón J. Sender, entre otros escritores exiliados hoy menos conocidos.

valba

Victor Alba, Diálogo sin testigos (1947).

Tal fue el éxito de estas ediciones, en papel de muy baja calidad y a un precio inicial de 25 francos, que a partir de la segunda serie, iniciada en enero de 1948, se empiezan a publicar dos títulos mensuales (y a 30 francos), pero, como explica Francisca Montiel Rayo, esta ambiciosa empresa, que se vio pronto en la necesidad de implementar una segunda subida de precio que lo situaría en los 50 francos, fue bastante difícil:

El encarecimiento del precio del papel, el pago del diez por ciento de las ventas acordado con los autores, la imposibilidad de vender en Francia las tiradas completas de las ediciones –que llegaron a alcanzar los cinco mil ejemplares– y los problemas que entrañaba su distribución en América –expansión que intentó poner en marcha Fernández Escobés– fueron algunas de las dificultades que marcaron la vida de la colección.

valba2

Victor Alba, La muerte falsificada (1948).

Antes de cerrar la colección esta se atrevió incluso a estimular la creación literaria entre sus lectores con la convocatoria un Premio Antonio Zozaya dotado con diez mil francos y cuya obtención comportaría la publicación de la obra. Según se anunciaba ya en la contracubierta del número 12:

Acontecimiento literario. Continuando con su obra de divulgación de la cultura española, para corresponder al favor creciente que recibe de sus numerosos lectores y para excitar la producción literaria dando a los jóvenes escritores la oportunidad de darse a conocer, La Novela Española, de acuerdo con un prestigioso periódico del exilio [¿L’Espagne?], estudian las bases de un concurso literario que llevará por título el nombre del insigne escritor Antonio Zozaya, rindiendo así un merecido homenaje a esta figura señera del periodismo y la literatura española contemporánea [que hacía poco, en 1943, había muerto en su exilio mexicano].

lope

El premio lo ganó Andrés María del Carpio (autor en 1931 de la música del «Himno a Andalucía») con la obra El Españolito, cuya extensión excedía en mucho la habitual en la colección, y quizá eso contribuyera a que no llegara a publicarse, aun cuando los miembros del jurado describieron al autor como un «escritor español, agudo y original, muy conocido y apreciado en la vida literaria de París» y expresaron su convencimiento de que no sería éste el último triunfo que obtendría. Andrés María del Carpio dejó abundante material inédito acerca del lenguaje, el cante y las costumbres andaluzas, pero antes de su muerte vio publicadas una variopinta serie de obras, como Juan García Morales, presbítero. Algunos rasgos del hombre y de su obra (Lyon, Imprimerie Juhan, 1946), Sonoridad del castellano (Madrid, Marsiega de Artes Gráficas, ¿1955?), Cartas galas. Febrero de 1939- julio de 1940 (Madrid, Ediciones Iberoamericana, 1960), La espera interminable (julio de 1940-septiembre de 1944), Madrid, Ediciones Iberoamericanas, 1964 o El canto del gallo. Ensayo de fonética descriptiva galla (Madrid, Ediciones Iberoamericanas, 1970).

salvadorjjff1952

Josep Salvador en 1952.

Por su parte, concluida La Novela Española, Salvador prosiguió con su labor de difusión y apoyo a las culturas peninsulares, y así por ejemplo en 1952 la librería se convirtió en una de las principales organizadoras de los Jocs Florals de la Llengua Catalana en el exilio, año en que recibieron los premios ordinarios Joan Barat (1918-1996), Edmon Brazès (1893-1980) y Albert Manent (1930-1914).

Sin embargo, no por ello abandonó Salvador su trabajo como linotipista en La Dépeche du Midi (donde ya había empezado a trabajar en 1944, cuando se llamaba La République du Sud-Ouest). La vida de este infatigable embajador en Toulouse de la cultura española llegó a su fin en febrero de 1974, poco antes de la muerte del dictador, y sus restos descansan en el cementerio municipal de Bourg St. Bernard. Es hasta cierto punto comprensible, pues, que buena parte de la cuantiosa documentación generada por la actividad de Salvador se conserve en el Instituto Cervantes de Toulouse. Sin embargo, otra parte de su legado se encuentra repartida, como es lógico, entre la Biblioteca de Catalunya y el Ajuntament de Palafugell.

Fuentes:

Anónimo, «Donen 74 llibres editats a l’Estat francés per un palafrugellenc», Avui, 17 de mayo de 2010.

Michel Baglin, «C’était la librairie des réfugiés espagnols à Toulouse», Texture, 18 de abril de 2009.

casona

Alejandro Casona, Flor de leyendas (1947).

Javier Campillo Galmés, «Josep Salvador, librero y editor del exilio en Toulouse», en Manuel Aznar Soler y José Ramón López García (eds.), El exilio republicano de 1939 y la segunda generación, Sevilla, Gexel (Grupo de Estudio del Exilio Literario)-Editorial Renacimiento, 2011, pp. 921-930.

Javier Campillo, «Josep Salvador y la Librairie des Editions Espagnoles de Toulouse».

Francisca Montiel Rayo,  «Semblanza de La Novela Española (1947- 1949)». En Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIX-XXI) – EDI-RED, 2016.

José Luis Morro Casas, «Antonio Soriano: los libros, su vida», en Alicia Alted Vigil y Manuel Aznar Soler, eds., Literatura y cultura del exilio español de 1939 en Francia, Salamanca, AEMIC (Asociación para el Estudio de los Exilios y Migraciones Contemporáneas)- Gexel, 1998, pp. 391-404.

Manuel Altolaguirre en Cuba (1939-1943)

Mi verso es de un verde claro

y de un carmín encendido:

Mi verso es un ciervo herido

que busca en el monte amparo.

José Martí

altolaguirreencuba

Manuel Altolaguirre en Cuba.

Cuando Manuel Altolaguirre (1905-1959) llega a Cuba lo hace con una amplia experiencia como impresor-editor, producto de su atribulada trayectoria en estos menesteres iniciada en la malagueña Imprenta Sur. Desde la creación de las revistas Ambos (1923), Litoral (1926-1929), Poesía (1931) o, en colaboración con su esposa Concha Méndez, Héroe (1932-1933), hasta las míticas y casi heroicas Ediciones Literarias del Comisariado del Ejército del Este durante la guerra civil, pasando por otras cabeceras como 1616 (1934-1935), Caballo Verde para la Poesía (1935-1936), dirigida por Pablo Neruda, o la célebre revista Hora de España (1937-1939), al desembarcar en la isla caribeña Altolaguirre había puesto en marcha las más diversas imprentas y en las condiciones más variopintas, lo que le había capacitado para adaptarse a todo tipo de circunstancias. Era previsible que no tardara en hacer lo mismo a su llegada a la isla caribeña.

Efectivamente, una de las primeras cosas que hizo en Cuba, gracias al apoyo de varios amigos y sobre todo a la ayuda económica (quinientos pesos cubanos) de quien sería su segunda esposa, la acaudalada Martía Luisa Gómez Mena, fue comprar una imprenta, a la que bautizó como La Verónica y que estrenó con una versión ampliada del libro de ensayos de Juan Marinello (1898-1977) Momento español (colofón del 18 de julio de 1939).

veronica1En los meses sucesivos saldrían de La Verónica varios catálogos para exposiciones de arte y una impresionante serie de revistas compuestas y encuadernadas a mano, a menudo fundadas y dirigidas por el propio Altolaguirre, como Nuestra España (1939-1941), dirigida por Álvaro de Albornoz (1879-1954), Atentamente (1940) o la diminuta revista literaria La Verónica que sale los Lunes (seis números de octubre a diciembre de 1942), donde alternan textos de sus compañeros de generación exiliados como consecuencia del resultado de la guerra civil (Pedro Salinas, Jorge Guillén, María Zambrano, Rafael Alberti, Emilio Prados), con otros de quienes conforman su nuevo contexto literario, como Agustín Acosta (1886-1979), Mariano Brull (1891-1956), Lydia Cabrera (1899-1991), quien en 1940 había publicado en La Verónica Cuentos negros de Cuba, o Cintio Vitier (1921-2009).

Sin embargo, de los más de doscientos títulos que Altolaguirre dejó a su paso por la isla, destacan los que forman la colección El Ciervo Herido, destinada sobre todo a poetas españoles clásicos y modernos. Se trata de una serie de preciosos volúmenes de 13,5 x 8,8 cm encuadernados en rústica y siempre de menos de cien páginas, que se estrena en julio de 1939, haciendo honor a su nombre, con los Versos sencillos del poeta modernista cubano José Martí (1853-1895), de quien poco después publicaría también Versos libres. La segunda entrega de la colección la reserva a su propio poemario Nube temporal, que reúne piezas dispersas en libros y publicaciones periódicas impresos en España, y que presenta «con un autógrafo de Jules Supervielle [“A Manolito Altolaguirre. Vuelvo a encontrarme en tu poesía con toda España, a la sombra y al sol de un gran poeta. Tu antiguo amigo Julio”] y un poema de Stephen Spender», que va situado al final del libro y que el poeta inglés escribió al recibir la falsa noticia de que Altolaguirre había muerto durante la guerra civil.

nubetemporal

Nube temporal, de Manuel Altolaguirre.

Sin embargo, acaso sea significativo de la conciencia de provisionalidad que debía de tener Altolaguirre acerca de su exilio la notable presencia de clásicos españoles en esta colección, e incluso los nombres y títulos elegidos son indicativos de una determinada mirada a la tradición española más reciente a la que, como editor, parece querer dar continuidad. Es el caso por ejemplo de la selección de Poemas escogidos que publica ya en 1939 de su amigo asesinado durante la guerra Federico García Lorca (1898-1936), pero no los son menos los casos, también aparecidos en 1939, de las Coplas a la muerte de su padre, de Jorge Manrique (c. 1440-1459), el Canto a Teresa, de José Espronceda (1808-1842) o La tierra de Alvargonzález de Antonio Machado (1875-1939).

En cuanto a los autores españoles vivos, llama la atención Sangre de España: elegía de un pueblo (1941), del periodista y dramaturgo gallego Ángel Lázaro Machado (1900-1985), que había visto truncada una prometedora carrera en el teatro en los años veinte y treinta (El circo de la verbena, La casada sin marido) y que ya en Cuba había dado a conocer un Cancionero español (1937), su Romance de Cuba y otros poemas (1937), La verdad del pueblo español (1939) y había reunido una selección de su obra en verso, Antología poética (1940) para la que Altolaguirre le había escrito el prólogo. Por su parte, el libro de Ángel Lázaro publicado en El Ciervo Herido va precedido de un prólogo escrito por otro escritor español exiliado en Cuba, el poeta valenciano Bernardo Clariana (1912-1962), quien, procedente de Santo Domingo (donde había publicado su primer libro de poesía, Ardiente desnacer), poco después se trasladaría hasta su muerte a «un piso miniatura de Perry Street en el Village, el barrio bohemio de Nueva York», al decir de Vicente Llorens.

lluvias

Lluvias enlazadas, de Concha Méndez.

Otras ediciones de poesía española destacadas de El Ciervo Herido son Lluvias enlazadas (1940), de Concha Méndez (1898-1986), al que precede un «retrato lírico» del poeta también exiliado Juan Ramón Jiménez (1881-1958), que por entonces se había establecido en Miami, o la edición de 1942 de las Églogas de Garcilaso de la Vega (1498-1536).

A la mayoría de poetas cubanos vivos a los que publica Altolaguirre en La Verónica, en cambio, los encuadra sobre todo en otra colección, Héroe, donde aparecen poemarios de Regino Pedroso (1896-1983), Nicolás Guillén (1902-1989) y Emilio Ballagas (1908-1954), entre otros. Pero sí publica en El Ciervo Herido, por ejemplo, al argentino establecido en Nueva York Alfonso de Sayons su Oda y jornada, o una nueva edición de las piezas teatrales de Pushkin Festín durante la peste y El convidado de piedra, en la misma traducción de O. Savich y el propio Altolaguirre que en 1938 había publicado en la barcelonesa Tipografía Catalana la AERCU (Asociación Española de Relaciones Culturales con la URSS).

pushkin2

Particular interés tienen algunas otras ediciones surgidas de una imprenta tan modesta como La Verónica, los 15 dibujos de Shum, por ejemplo. Su autor, cuyo nombre real era Alfons Vila (1897-1967), se había hecho muy popular como ilustrador en los años veinte en cabeceras humorísticas catalanas como El señor Daixonses/La senyora Dallonses y L´Esquella de la Torratxa, y al final de la guerra, también tras pasar episódicamente por Santo Domingo, se estableció en Cuba durante un tiempo, antes de pasar a Estados Unidos y entrar en la Metro Goldwin Mayer como diseñador de carteles cinematográficos.

sayons

Y también es digno de mención el libro en que en 1941 se recoge la pieza teatral de Concha Méndez El Solitario. Misterio en un acto, que va precedido de un precioso prólogo de Maria Zambrano (1904-1991) y con ilustraciones de Macarena Smerdou Picazo y Manuel Altolaguirre. En 1998, las Ediciones Caballo Griego para la Poesía tuvieron el acierto de estrenar su colección El Público con una edición facsímil, preparada por Maya S. Altolaguirre y Manuel Bonsoms, de esta bella edición.

soldadocubano

Cubierta de la novela póstuma del novelista cubano Pablo de la Torriente-Brau (1901-1936) Aventuras del soldado desconocido cubano, publicada en La Verónica.

En cuanto Altolaguirre se trasladó a México, donde por supuesto prosiguió con su labor impresora, creó Aires de Mi España, una muy conocida colección de libritos, también de muy reducido tamaño (el mismo formato que El Ciervo Herido), encuadernados en rústica, con unas muy características cubiertas impresas a dos tintas y también protegidos con sobrecubiertas en papel cristal. En ella publicó antologías de autores españoles clásicos, como Garcilaso de la Vega, San Juan de la Cruz, Lope de Vega, Quevedo o, cómo no, Luis de Góngora, siempre seleccionadas por el propio Altolaguirre. Junto a ellos, algún otro cronológicamente más cercano, como Miguel de Unamuno (El Cristo de Velázquez, 1947).

airesgong

Poesía de Góngora, México, Ediciones de La Verónica, 1943.

Fuentes:

García Chacón, Irene (2015). «Semblanza de Manuel Altolaguirre (1905- 1959)». En Biblioteca Virtual Miguel de Cervantes – Portal Editores y Editoriales Iberoamericanos (siglos XIX-XXI) – EDI-RED: http://www.cervantesvirtual.com/obra/semblanza-de-manuel-altolaguirrebolin/

Jorge Domingo y Róger González, eds., Sentido de la derrota, Bellaterra, Gexel-Cop d´Idees (Cuba 1), 1998.

Vicente Llorens, Memorias de una emigración. Santo Domingo 1939-1945, Barcelona, Ariel, 1975.

Gonzalo Santonja, Un poeta español en Cuba. Manuel Altolaguirre, Barcelona, Círculo de Lectores, 1995.

Edicions La Branca (o Ignacio Agustí dándose pisto)

De entre la labor del poeta, crítico literario y editor catalán Tomàs Garcés (1901-1993), una de las actividades que menos rastro dejó fue la creación de unas efímeras Edicions La Branca (cuyo nombre acaso homenajea el libro homónimo de Marià Manent, que fue el primero que éste dio a la imprenta, cuando contaba sólo veinte años).

pons

Josep Sebastià Pons (Joseph-Sébastien Pons).

A partir de los libros publicados, pueden aventurarse algunas de las características del funcionamiento de Las Edicions La Branca. El primer título que apareció en este sello, en los meses iniciales de 1930, fue L’aire i la fulla, del poeta rosellonés Josep Sebastià Pons (1886-1962). El epistolario entre Garcés y Pons permite reconstruir algunos detalles acerca del proceso, y saber por ejemplo que ya en carta fechada en Motpellier en marzo de 1929 el poeta rosellonés expresaba sus dudas acerca de que el proyecto de publicar su libro llegara a buen puerto: «Pensaba tener alguna noticia de L’aire i la fulla. ¿Habréis perdido el manuscrito o será que la edición de esta obrita presenta dificultades? […] Tendré que establecer otro manuscrito». En abril cuenta que poco a poco sigue avanzando en este libro, del que anuncia que es posible que esté en condiciones de publicarlo a finales de año, si encuentra editor. Otra epístola fechada con más precisión, el 13 de junio de 1929, permite deducir que Garcés se ha ofrecido a publicarle el libro, y Josep Sebastià Pons se lo agradece, le remite algunos poemas para que intente darlos a conocer en las revistas a las que está vinculado y le anuncia que lo tendrá en cuenta cuando haya pulido un número suficiente de poemas para formar volumen. Sin embargo, el contacto personal que mantenían en visitas recíprocas crea algunas lagunas en el epistolario que resultan insalvables. Aun así, según reza el colofón de L’aire i la fulla, el libro terminó de imprimirse el 7 de junio de 1930, si bien la primera constancia de que lo ha recibido que aparece en el epistolario lo hace en una misiva sin fecha, pero de la que puede deducirse que está escrita no muy avanzado el año: «He recibido a su debido tiempo L’aire i la fulla. Es una edición perfecta y ejemplar que me ha dado alegría para todo el año 1930 y lo que vivamos.» Es el único título de la colección que se imprimió en L´Estampa, pero aventurar los motivos es arriesgado.

airefulla

El segundo libro de la colección es el que se considera uno de los mejores del poeta un tanto olvidado Jaume Agelet i Garriga (1888-1981), a quien Pere Gimferrer describió como «un poeta poco conocido, pero muy estudiado por algunos y muy apreciado por los pocos que hemos llegado a leerlo». Su título era Hostal dels núvols y apareció en la Imprenta Altés ese mismo año. También el tercer libro de la colección, Paradís, de Tomás Garcés, sale de la Imprenta Altés, así como los siguientes, y se pone a la venta en 1931. Lo interesante es que en sus páginas finales anuncia como en prensa una obra en prosa de Garcés que tardaría aún décadas en aparecer. Cuando finalmente en 1962 la publicó, formando parte de Quaderns de La Selva, en una edición de 500 ejemplares en Amics de la Poesia e impresa en La Polígrafa, la precedió de una clarificadora Nota del Autor, pues anuncia como motivos el hecho de que relegara ese texto al olvido, después de trabajar en él durante más de quince años:

Ahora ya no se lleva mucho (quizá nada). Pero antes, en la página final de los libros, allí donde se enumeraban los libros del autor, solía haber un apartado en que se anunciaban los títulos “en preparación”. Hojeando por casualidad mi Paisatges i lectures veo las obras que por entonces preparaba y me viene a la memoria que en 1926 pensaba efectivamente en una recopilación que debía titularse La beutat del món. A decir verdad, no trabajé mucho en él. Las pocas páginas reunidas en la carpeta correspondiente (escritas entre 1920 y 1937) son las que constituyen la primera parte de este libro.

elvelerSin embargo, quizá el título más interesante de las Edicions La Branca sea el poemario con el que se dio a conocer Ignasi Agustí (1913-1974) como poeta en lengua catalana, El veler (1932). En su libro de memorias, el propio Agustí ha dejado también algunas pistas acerca de las circunstancias de su publicación, pero al mismo tiempo, quizá por error involuntario o para despistar a sus biógrafos, introduce algunas pistas falsas.

He conocido muchos [poetas] y algunos muy importantes. Hablaré sólo de dos o tres a los que traté entre 1933 y 1935, la mayoría a través de una asociación que se llamaba Amics de la Poesia, fundada por Tomàs Garcés, Marià Manent y el orfebre [Ramon] Sunyer, y de cuya junta nos hicieron miembros a Joan Teixidor y a mí. Amics de la Poesia publicaba mensualmente una revista así titulada, en la que aparecieron algunos de nuestros versos.

Ganas1Ciertamente, Amics de la Poesia era una asociación creada en 1921 por los escritores Josep Carner, Carles Soldevila y Marià Manent, entre otros, cuyo objetivo era divulgar la poesía, sobre todo mediante lecturas y conferencias, pero sin duda la revista mensual a la que Agustí se refiere es la excelente Quaderns de Poesia, de la que se publicaron ocho números entre junio de 1935 y los primeros meses de 1936, una brillante publicación con apariencia de libro, de unas 32 páginas, que se imprimía en la Casa Castells-Bonet y que tenía como sede administrativa la benemérita Llibreria Catalònia de López Llausàs. En la redacción figuraban J.V. Foix, Garcés, Manent, Riba y el propio Teixidor, que muy probablemente fuera quién introdujo a Agustí en la revista. En ella se publicaron, junto a poemas y textos de algunos compañeros generacionales de Agustí como Rosselló Pòrcel, Josep M. Boix i Selva y Martí de Riquer, así como a algunos de sus profesores en la Universitat de Barcelona, como Carles Riba o Guillermo Díaz Plaja, textos en prosa y en verso de Supervielle, García Lorca, Stephen Spender, Cliford Dyment, Paul Éluard o Manuel Altolaguirre, entre muchos otros del calibre similar.

Ignacio Agustí (1913-1974).

Ignacio Agustí (1913-1974).

En realidad, los «algunos de nuestros versos» a los que alude Agustí que aparecieron en Quaderns de Poesía se redujeron en su caso al poema «Les fonts properes», que reproduce completo y al pie de la letra en sus memorias precediéndolo de un falsamente modesto «Recuerdo –o creo recordar– unos míos que decían así». En cuanto al período que establece, por otra parte, también hay un pequeño error, pues este único poema de Agustí aparecido en esta espléndida revista se publica en el sexto número, fechado ya en enero de 1936.

Sin embargo, y pese a que publicó elogios a la obra, parece que el compromiso de Garcés y sus Edicions La Branca con el poemario El veler de Agustí fue muy limitado, pues, según cuenta su biógrafo Sergi Dòria, de las gestiones y el seguimiento de la obra se ocupó su compañero de universidad Salvador Espriu y la obra se distribuyó a partir de marzo por suscripción entre los alumnos, sobre todo de las facultades de Derecho y de Filosofía y Letras de la Universidad de Barcelona. Un poco endogámico todo, sí.

grupsalinas

De izquierda a derecha: Ignacio Agustí, Joan Teixidor, Félix Ros, Pedro Salinas, Tomàs Garcés y Fernando Díaz-Plaja en diciembre de 1933.

No hay noticia de otros títulos con pie de las Edicions La Branca, y el hecho de que Garcés se comprometiera a continuación en otros proyectos y el alzamiento militar que desembocó en la guerra civil española inducen a pensar que el estreno de Agustí fue la última publicación de esta breve iniciativa.

Fuentes:

El epistolario Garcés puede consultarse en la página del IEC.

La revista Quaderns de Poesia, en la de ARCA.

Ignacio Agustí, Ganas de hablar, Barcelona, Planeta (Espejo de España. Biografías y Memorias 3), 1974.

Doria, Sergi, Ignacio Agustí, el árbol y la ceniza. La polémica vida del creador de «La saga de los Rius», Barcelona, Destino (Imago Mundi 244), 2013.

Pere Gimferrer, «Conferencia de clausura», en Antonio Monegal y José María Micó, coord. y ed. de las actas del simposio Federico García Lorca y Cataluña, Barcelona, Institut Universitari de Catalunya- Universitat Pompeu Fabra- Diputació de Barcelona, 2000, pp. 139-152.

Juan Ramón Jiménez y la osadía de la juventud

Los cuatro números que aparecieron de una revista tan fascinante como lo fue Índice (1921-1922) constituyen por sí solos una espléndida panorámica de la poesía española de los apenas dos años que duró esta empresa. Fundada por el exquisito poeta Juan Ramón Jiménez (1881-1958), cuya vertiente como esmerado editor quedó ensombrecida por su brillo como escritor, en sus páginas pueden encontrarse autores de diferentes generaciones, consecuente con la declaración que aparece ya en la última página del número inicial:

JuanRamonJimenez

Juan Ramón Jiménez.

Índice no es revista de «grupo». Sus redactores son escritores y artistas de las más distintas tendencias, españoles e hispanoamericanos, unidos sólo por el interés común de la exaltación del espíritu y por el gusto de las cosas bellas. En sus páginas, cabrá todo lo que signifique «vida», desde lo más acrisolado hasta lo más nuevo, desde lo más llano hasta lo más insigne, desde lo más oculto hasta lo más abierto; y su aspiración es llegar a definir y deslindar, del modo más completo y perfecto posible –con un criterio amplísimo y estrechísimo a un tiempo–, la calidad más noble del genio español e hispanoamericano.

Basta una mirada a la tabla de contenidos del primer número para corroborar esta intención intergeneracional: Azorín (1873-1967), Enrique Díez-Canedo (1879-1944), Juan Ramón Jiménez, José Ortega y Gasset (1883-1955), Pedro Henríquez Ureña (1884-1946), José Moreno Villa (1887-1955), Corpus Barga (1887-1975), Gabriel García Maroto (1889-1969), Adolfo Salazar (1890-1958), Pedro Salinas (1891-1951), y en ya en el segundo número, aparecido también en 1921, se añaden los nombres de Ramón Gómez de la Serna (1888-1963), Jorge Guillén (1893-1984), Antonio Espina (1894-1972), José Bergamín (1895-1983), Federico García Lorca (1889-1936)…

083c0-federico-garcia-lorca

Federico Garcia Lorca.

Los tres primeros números de esta revista salieron de la imprenta de un personaje clave de esos años ya mencionado, Gabriel García Maroto, «ese gran tipo humano, poeta, crítico, pintor, impresor, que a la sazón tenía una imprenta en Madrid», en palabras del intelectual granadino José Mora Guarnido. En junio de ese mismo año 1921 García Maroto se ocupó, corriendo él mismo con los gastos, de otra de las ediciones importantes de esa etapa de la literatura española, el poemario con el que se dio a conocer García Lorca (Libro de poemas), y según ciertas versiones se ocupó incluso, a la vista de la tardanza del autor y para evitar recompaginar el libro, de escribir las palabras preliminares a modo de prólogo («Palabras de justifiación»). El cuarto número de Índice, cuya novedad más importante es la impresión a dos tintas, se elaboró ya en los Talleres Poligráficos, en los que Juan Ramón haría imprimir algunos de sus libros en esos principios de los años veinte (Poemas y Belleza, por ejemplo). Se sabe de un quinto número de Índice, cuyo sumario se incluyó en el quinto del que incluso se corrigieron pruebas pero nunca llegó a publicarse. La distribución corrió a cargo de la editorial La Lectura, que en 1914 le había publicado a Juan Ramón Platero y yo.

GabrielGarcíaMaroto

Gabriel García Maroto.

Tan interesante o más que la revista fueron los seis volúmenes que en 1923 auspició la revista, en una Biblioteca Índice en la que aparecieron, en orden de numeración, la segunda edición de Visión de Anahuác, de Alfonso Reyes; El cohete y la estrella, de José Bergamín, precedida de una «caricatura lírica» de Juan Ramón; la Fábula de Polifemo y Galatea, de Luis de Góngora, en edición de Alfonso Reyes; Signario (versos), de Antonio Espina; Niños, de Benjamín Palencia, ilustrada con una silueta del autor obra de Juan Ramón Jiménez; y  el primer libro de poemas de Pedro Salinas, Presagios (con un texto preliminar de Juan Ramón Jiménez) que, como se encargó de esclarecer Raquel Sánchez, fue objeto de una cierta polémica, porque desde el tercer número se ocupó tanto de la impresión como de la distribución la Librería y Editorial Rivadeneyra:

la distribución de estas obras corrió a cargo de la ya mencionada Librería y Editorial Rivadeneyra, la cual acabó en pleitos con el poeta [Juan Ramón Jiménez] por la negativa de la editorial a encargarse en firme de 400 ejemplares del libro de Pedro Salinas Presagios. La resolución del litigio tuvo lugar en mayo de 1925 y liberó de sus compromisos a ambas partes, obligándoles a pagar las costas del juicio a medias.

Presagios1Ha sido motivo de muchas confusiones el hecho de que el libro de Salinas apareciera con el número 7, pues el hecho de que el sexto, Cartas y versos a Juan Ramón, de Rubén Darío, no llegara a publicarse, ha dado pie a que, entre otras cosas, a que en ocasiones se considerara ésta una colección formada por siete títulos. A través del epistolario entre Alfonso Reyes y Julio Torri es posible saber además que el primero le pidió con insistencia a Torri un conjunto de material suficiente para componer un octavo número de la colección, advirtiéndole en carta fechada en Madrid el 6 de julio: «Todos me dicen bien de ti, pero tú no mandas el original de un libro tuyo, inédito y perfecto, para la Biblioteca Índice de Juan Ramón, más trescientas pesetas que te tocaría costear más o menos».

De la estructuración de Presagios, que incluía –con algunas variantes– dos sonetos aparecidos previamente en Los lunes del Imparcial y dos poemas en verso libre publicados en las páginas de la revista España, se ocupó también Juan Ramón Jiménez, haciendo buena la fama de que goza de haber sido un editor total, meticuloso, responsable tanto de los originales que publicaba como del papel sobre el que se imprimían sus textos, así como de todos los detalles intermedios y posteriores. Aun así, en carta al autor el poeta de Moguer le informa a toro pasado de los cambios que ha introducido, a partir de la cincuentena inicial de poemas que Salinas le había entregado: «Deseo que le guste a usted el orden en que he puesto las poesías, y, antes, mi selección. Verá que he copiado una poesía de las desechadas por usted, y que he separado, en cambio, una de las otras». Y en su libro de memorias La arboleda perdida Rafael Alberti dejó constancia de una escena que pone de manifiesto también que el editor de Moguer se tomaba las cuestiones editoriales casi como cuestiones personales:

Aquella tarde, con un ejemplar de Signario en la mano, protestaba el poeta de sus imperfecciones tipográficas. Había encontrado erratas, letras sucias, renglones caídos, y todo esto iba a quitarle el sueño.

–También –nos dijo– en la edición de la Fábula de Polifemo y Galatea, de Góngora, preparada por Alfonso Reyes, se le han escapado a éste otras horribles erratas: en vez de corona dice corna; en vez de entre, enter, etc. España ha perdido su gran tradición tipográfica. Fíjense en este libro inglés –nos mostró uno, moderno, de Keats–. ¡Qué finura, qué gracia, qué delicadeza! Quisiera conseguir para la Biblioteca Índice lo mismo, pero, por lo visto, esto aquí es imposible.

DaliMVillaBuñueLorca

De izquierda a derecha: Salvador Dalí, José Moreno Villa, Luis Buñuel, Federico García Lorca y el historiador José Antonio Rubio Sacristán.

Además, la influencia de Juan Ramón en las iniciativas editoriales que llevaron a cabo tanto Bergamín como Manuel Altolaguirre y Emilio Prados, entre otros, es palmaria y no admite mucha discusión. Por todo ello, resulta más lamentable que, después de haberse convertido en uno de sus principales referentes, en uno de sus más importantes valedores, en el editor en el sentido más fuerte del término de muchos de ellos, Juan Ramón Jiménez acabara enzarzado en una polémica con la mayoría de miembros de la generación del 27, que salpicó también a su relación con Pedro Salinas, quien, incluso en el ámbito creativo, tanto debía a la obra literaria del poeta de Moguer. También es cierto que muchos de ellos a posteriori reconocieron –hasta cierto punto– lo injusto de ese trato, como es el caso de Rafael Alberti en sus memorias, pero meterse con Juan Ramón se convirtió en poco menos que un deporte y en un signo de juventud y de vanguardismo, a rebufo de la famosa carta que le mandaron Buñuel y Dalí informándole de que su obra les repugnaba «profundamente por inmoral, por histérica, por cadavérica, por arbitraria». A nadie escapaba la proximidad entre Buñuel y Dalí y los miembros de la generación del 27 (y ninguno de ellos salió en defensa del poeta moguereño). La espoleta de la sucesión de rupturas posteriores fue al parecer la respuesta de Juan Ramón declinando la invitación a participar en el homenaje a Góngora alegando: «El carácter y la extensión que Gerardo Diego pretende dar a este asunto de la Revista de Desoriente, me quitan las ganas de entrar en él. Góngora pide director más apretado y severo, sin claudicaciones ni gratuitas ideas fijas provincianas». La réplica de Gerardo Diego no se hizo esperar, y de inmediato la polémica se convirtió en poco menos que un «todos contra uno».

GranellSalinas

Pedro Salinas (a la izquierda de la imagen) a su llegada a Santo Domingo.

La verdad es que los motivos claros de aquellas peleas –asegura Alberti– siguen siendo para mí completamente oscuros. Es un secreto que Juan Ramón se llevó con su muerte. […] ¿Cómo explicar que con José Bergamín, exaltador hasta la hipérbole de la obra del poeta y a quien considerábamos una especie de secretario permanente suyo, se peleara, y al final de manera definitiva, porque, según él, puntuaba mal, debiendo limitarse solamente a sus aforismos, dejando a un lado la prosa larga, para la que –afirmaba rotundo– no servía? ¿Pues y con personas tan excelentes como Salinas y Guillén, alabadísimos poetas al principio y motejados luego de «retóricos blancos», de ingenieros –o algo parecido–, máximo insulto este a su gran poesía de perfiles precisos, sostenidos sobre cimientos, como la de Guillén sobre todo?

Convendría añadir que si en 1932 Juan Ramón retiró sus poemas de la segunda edición de la influyente Antología de Gerardo Diego con un ya célebre «Quedan hoy retirados poemas y amistad», ello fue precedido de durísimas palabras de Bergamín, en un artículo sobre Salinas, acerca de la obra de quien fuera su mentor y editor («amoralismo esteticista», «falsa e inhumana», «agonizante y espectacular»…), y, por cierto, no hay motivo para suponer que Alberti no estuviera al corriente de todo ello.

Parafraseando el célebre título de un magnífico libro de Mario Muchnik, quizá sea cierto que lo peor no son los autores; tal vez lo sean los autores metidos a editores…

AlonsoAubSalinas

Tres representantes de la generación del 27. De izquierda a derecha: Dámaso Alonso, Max Aub y Jorge Guillén.

Fuentes:

Rafael Alberti, La arboleda perdida, Barcelona, Bruguera (EL Libro Amigo 1502), 1984.

Francisco Fuster García, «Juan Ramón Jiménez (Moguer, Huelva, 1881- San Juan, Puerto Rico, 1958)», semblanza en el portal EDI-RED.

Julio Neira, De musas, aeroplanos y trincheras. Poesía española contemporánea, Madrid, Universidad Nacional de Educación a Distancia, 2015.

Raquel Sánchez García, «Juan Ramón Jiménez y el mercado editorial», Dicenda. Cuadernos de Filología Hispánica, núm. 21 (2003), pp. 301-308.

Gregorio Torres Nebrera, «Presencia de Juan Ramón Jiménez en la poesía de Pedro Salinas», en Actas del Congreso Internacional Conmemorativo del Centenario de Juan Ramón Jiménez. Tomo II, Huelva, Diputación Provincial de Huelva, Instituto de Estudios Onubenses, 1983, pp. 569-580.

Julio Torri, Epistolarios, edición de Serge I Zaïtzeff, México, Universidad Nacional Autónoma de México (Nueva Biblioteca Mexicana 108), 1995.

James Valender, «García Maroto y el Libro de poemas de García Lorca», Nueva Revista de Filología Hispánica, vol. 4, núm 1 (1996), pp. 156-165.

Salvador Espriu, editor

En su estudio de la vida y la obra de quien sin duda fue el mejor amigo de juventud del escritor Salvador Espriu (1913-1985), Roberto Mosquera cita tres fragmentos de su epistolario que permiten atisbar algunos aspectos del funcionamiento de la colección que, junto con algunos compañeros de universidad, puso en marcha Espriu.

Salvador Espriu.

En el último número de 1934, la revista Mirador hacía balance de lo que había sido el año literario y anunciaba ya la aparición de esta iniciativa, destinada a dar a conocer a la nueva promoción de jóvenes escritores que estaba gestándose en los aledaños de la Universitat de Barcelona, mencionando específicamente la próxima aparición de novela breve de Espriu Miratge a Citerea y explicando que se sostendría económicamente mediante un sistema de suscripción. La publicación del pequeño y distinguido volumen de poemas El veler de Ignacio Agustí (1913-1974), que había empleado este mismo sistema, probablemente les había servido de banco de pruebas, así que se intentó aplicar a una colección que en principio estaba abierta a todos los géneros literarios y en cuyo nombre convivían las resonancias de la cultura clásica con el acrónimo de Les Edicions D´Ara (las ediciones de ahora), así como el título de un poema reciente de Rosselló-Pòrcel (1913-1938). Muy poco después, el 18 de enero de 1935, aparece una nota en la cuarta página del periódico La Publicitat en que se presenta de nuevo esta colección, no vinculada a ninguna editorial y en la que, con Espriu a la cabeza, participan también Ignasi Agustí, Joan Teixidor (1913-1992), Bartomeu Rosselló-Pòrcel  y Tomàs Lamarca.

Joan Teixidor (1913-1992)

Joan Teixidor (1913-1992)

En Rosselló-Pòrcel. Vida y poesía, Mosquera reproduce el siguiente fragmento de una carta del poeta mallorquín fechada el 22 de julio de 1935, que sin duda es respuesta a una anterior de Espriu:

Y segundo, pasemos a LEDA. Todo lo que me cuentas me parece muy juicioso y lo apruebo in totum y por escrito, si es que hacía falta, porque ya sabes hasta qué punto estoy de tu parte. De mi propuesta, vista tu intención de publicar dos libros al año, y teniendo en cuenta nuestra lamentable situación administrativa, olvídalo. Se trataba de un proyecto para este mismo verano.

A falta de la carta previa de Espriu, Mosquera deduce con buen criterio que muy probablemente Espriu había puesto a disposición de Rosselló-Pòrcel la colección para que diera a conocer su nueva obra, pero no podrían publicarla hasta el año siguiente (1936), puesto que en ese momento, además de la novela breve del propio Espriu, acababa de salir también la pieza teatral de Agustí Benaventurats els lladres, y el sistema de financiación elegido no debía de dar para muchas alegrías.

Benaventurats els lladre, de Ignasi Agustí.

Benaventurats els lladre, de Ignasi Agustí.

En otra carta del mes siguiente (1 agosto de 1935), Rosselló-Pòrcel proporciona información adicional y se refiere a esa aparición de la obra de Agustí:

De LEDA, no se hable más. Eres el amo. Haz lo que quieras. ¡Ojo!, si hay dinero. Dime en qué situación estamos, porque quizá te haría una propuesta. De los otros qué podría decirte que no fuera repetirme. Tú mismo abrevias el capítulo, así que yo te sigo. Espero los lladres benaventurats.

Pero más interesante que esta alusión es el postscriptum a esta misma carta escrita desde Mallorca, que permite constatar la intención de Espriu de ampliar el sistema de distribución, o acaso buscar salida a libros impresos y no vendidos, mediante un sistema de goteo a librerías que estuvieran en disposición de quedarse en depósito ejemplares, contando quizá con que del transporte de los ejemplares se ocuparan los propios miembros del grupo, pues de otro modo no podía ser en ningún caso rentable: «De ledas no venderíamos muchos por aquí. Manda algunos a la Librería Escolar. Plaza Cort. Es la mejor y vende los Quaderns Literaris.»

Letizia en los míticos Quaderns Literaris de Janés.

Letizia, otra de las obras de Espriu, en los míticos Quaderns Literaris de Janés.

Este último pasaje permite aventurar que quizá en algún sentido uno de los modelos de este grupo de escritores metidos a editores fueran los Quaderns Literaris de Josep Janés i Olivé (1913-1959), que en realidad ni en presentación (mucho más modesta), ni en catálogo (mucho más abierto) ni en distribución (mucho más profesionalizada) se parecía en nada a LEDA, si bien muy pronto empezó a acoger tanto obra propia como traducciones de este grupo de escritores, hasta el punto que sabemos que el 21 de julio de 1934 Espriu ya había revisado pruebas de la reedición en los Quaderns janesianos de su obra Laia (cuya primera edición es del año anterior) y, a decir de la estudiosa de Espriu Rosa Delors, «Con Josep Janés, Espriu entra en la nómina de los escritores del momento».

Janésn-9_foto

Josep Janés i Olivé.

Con estos breves pasajes del epistolario basta para ver hasta qué punto Espriu llevaba las riendas de este proyecto más o menos colectivo, que no tardó en fracasar estrepitosamente. Pese a lo esmerado de las ediciones, de las tiradas numeradas y firmadas impresas sobre papel especial, etcétera, lo más probable es que el sistema de suscripción no fuera sostenible, y que para los autores implicados publicar en LEDA fuera poco menos que autofinanciarse la edición, algo que no todos los implicados en esta aventura podían permitirse con la misma despreocupación con que sí podía hacerlo Espriu, cuyas primeras ediciones (Israel, El doctor Rip, Laia y Aspectes) corrieron a cargo de su padre, si bien en algunos casos se hizo cargo de la distribución la Llibreria Catalònia de Antoni López Llausàs. Rosselló-Pòrcel, por ejemplo, estaba viviendo en la Residencia de Estudiantes y cursando estudios en la Universitat de Barcelona gracias a una beca, y Agustí estaba también solo en Barcelona porque su familia, a raíz del descalabro del negocio paterno, se había trasladado a Madrid, así que en principio el sistema de las suscripciones podía parecer muy oportuno. El problema es que, siendo el público potencial el grupo de estudiantes y profesores amigos, pese a la difusión de la obra que pudieran llevar a cabo en las plataformas periodísticas a las que estaban vinculados algunos de estos posibles suscriptores (Guillermo Díaz-Plaja, Teixidor, Agustí, etc.), difícilmente el proyecto tenía posibilidades de crecer y establecerse como negocio. Por ello, es muy lógico que, cuando estos jóvenes escritores empezaron a entrar en tratos con editoriales bien dirigidas, abandonaran este proyecto. No deja de ser también significativo que los autores hayan postergado estas obras iniciales al olvido, e incluso en el caso de Espriu dejó constancia de los defectos en la edición de estas obras, muy resultonas como objetos pero con más errores de los aceptables en una edición profesional. Escribía en el volumen de sus obras completas acerca de El doctor Rip:

No sabía apenas nada del catalán gramatical. No lo había aprendido porque nadie, durante la dictadura de Primo de Rivera, nos lo había enseñado […] La venta, a tres pesetas el ejemplar –un precio no precisamente barato–, y la distribución en la Llibreria Catalònia, salió el año 1931 […] Además de tratarse de un error en esencia, está llena de descuidos, de errores de lenguaje, a pesar del anónimo corrector de pruebas, que no fue muy escrupuloso.

Ignacio Agustí (1913-1974).

Ignasi Agustí.

Por supuesto, no faltó quien se cebara en esos errores e incluso los especificara en el momento de escribir las primeras reseñas a este estreno de Espriu en el panorama de las letras catalanas.

A veces, echando la vista atrás en la historia editorial uno se encuentra con situaciones e iniciativas que resultan muy actuales. Sólo que ahora empleamos términos como «crowdfunding», «indy» y «autoedición» y así parecen más novedosas.

 

Fuentes:

Rosa M. Delors i Muns, Salvador Espriu. Els anys d´aprenentatge, 1929-1943, Barcelona, Edicions 62 (Estudis i Documents 47), 1993.

Salvador Espriu, Obres completes 3 (Narrativa 1), edición a cargo de Francesc Vallverdú, Barcelona, Edicions 62, 1986.

Roberto Mosquera, Rosselló-Pòrcel. Vida i poesía, Palma de Mallorca, Documenta Balear (Menjavents 111), 2013.

Tanto de la revista Mirador como del periódico La Publicitat publicados en los años treinta puede accederse a una edición digitalizada en ARCA.