El acto de editar como acto de escritura/lectura. Entrevista a Gustavo Guerrero

Gustavo Guerrero (Caracas, 1957), profesor universitario, crítico literario y ensayista, escritor y consejero literario para el ámbito de la lengua española en Gallimard, desde hace ya varios años ha asistido desde una posición privilegiada a los procesos de internacionalización de la literatura española y latinoamericana, en los que París ha desempeñado un papel fundamental.

expo-sarduyguerrerowal176

Gustavo Guerrero y el editor François Wahl (1925-2014).

Llegas a París, habiéndote graduado en Derecho en la Universidad Andrés Bello, ¿qué te lleva a París?

En realidad, el viaje a París supuso una ruptura. Durante mis últimos años en Caracas vivía una doble vida: de día era un joven abogado especializado en derecho financiero (trabajaba en la colocación de bonos de la deuda pública en los mercados extranjeros) y de noche escribía reseñas y notas bibliográficas para el suplemento literario del periódico El Universal (por entonces uno de los más importantes de Venezuela) y también para otras publicaciones nacionales y extranjeras (entre ellas, la famosa Vuelta de Octavio Paz). Llegó un momento en que se hizo imposible seguir sirviendo a estas dos coronas.

genette

Gérard Genette (París, 1930).

La Fundación para la Cultura y las Artes de Caracas me ofreció una salida al otorgarme una beca de estudios en teoría y crítica literaria sobre la base de un dosier formado por mis artículos. Así salí de Venezuela y del mundo del derecho; así llegué a París y al departamento de teoría literaria de la Escuela de Altos Estudios en Ciencias Sociales. Pero el derecho y las finanzas no desaparecieron del todo. Han sido, por el contrario, dos herramientas esenciales para ejercer cabalmente el oficio de editor.

Cuando entras en la Escuela de Altos Estudios en Ciencias Sociales, Gerard Genette (n. 1930), que dirigió tanto tu licenciatura como tu doctorado, era ya una estrella de los estudios literarios, pero en 1982, justo cuando tú te diplomas, publica un ensayo tan influyente como el Palimpsestos. ¿Qué puedes contar del Genette profesor y de su influencia sobre tu modo de afrontar la literatura? Porque creo que proponía, sobre todo en Figuras III, un método de análisis de textos literarios muy útil y productivo.

Palimpsestos fue primero un seminario de dos o tres años en la Escuela, y luego una lectura capital. ¿Qué decía Genette en ese libro? Afirmaba que el sentido de una obra literaria no dependía de la sola estructura de su texto (algo que en aquel entonces aún parecía bastante herético) sino que variaba en función del entorno de ese texto y, en particular, de la manera como el objeto libro, a través de sus cubiertas, ilustraciones, cuartas de forro, solapas, etc., trataba de inducir o incluso de imponer una cierta interpretación. Para mí fue el descubrimiento de que el acto editorial podía ser un acto de escritura/lectura que implicaba la imposición de un sentido y secretaba (o trataba de secretar) un horizonte de recepción determinado. Editar era algo más que hacer libros; era conferir un sentido, formular una propuesta de lectura.

¿Cuáles eran tus experiencias editoriales cuando llegas a Gallimard?

logoduseuil

Logo de Éditions du Seuil, obra de Robert Lapoujade, que reproduce su sede entre 1945 y 2010: rue Jacob, 27.

Es una historia un poco larga. Antes de entrar a Gallimard, estuve trabajando durante tres años en Editions du Seuil. Allí me inicié en el oficio, junto a Severo Sarduy y a François Wahl. Todo partió de Genette, que también formaba parte del equipo de le Seuil (por entonces dirigía la colección Poétique). Recuerdo que el tema de mi tesina en la Escuela fue el concepto de neobarroco en la obra de Sarduy. Gracias al apoyo de Andrés Sánchez Robayna, ese trabajito universitario, algo retocado, se editó en Barcelona con el título rimbombante de La estrategia neobarroca (1988). Pero antes de que se publicara, Genette se lo envió al propio Sarduy y éste se lo dio a leer a François Wahl, que era como el gran mandarín de toda el área de humanidades y ciencias sociales en la editorial. Ambos me propusieron que leyera y redactara informes para las colecciones de literatura extranjera.

Fueron unos años inolvidables. Se trabajaba muy a gusto, dentro de un clima de efervescencia, camaradería e informalidad. Todavía soplaban los vientos libertarios del mayo francés por los corredores de la casita de la rue Jacob. Cada libro se leía y se discutía con rigor, con apasionamiento, como si todos participaran en una misma aventura literaria, cultural y política. Redactar un informe era como realizar un ejercicio de crítica en el que se daba por sentado que la responsabilidad de un editor no se limitaba a garantizar un nivel de ventas. Había también una responsabilidad intelectual de saber por qué se hacía lo que se hacía, cómo y para quién. En la rue Jacob aprendí así a redactar informes, cuartas de forro y solapas, comunicados de prensa y hasta documentos comerciales; pero sobre todo a Seuil le debo una idea de lo que significa editar.

croixdusud

Un ejemplo de La Croix du Sud de Caillois: Sécheresse, de Graciliano Ramos.

Tu entrada como director del ámbito de la lengua española en Gallimard se produce en 1996 para sustituir a Severo Sarduy (1937-1993). Por la fecha en que se produce esa llegada de Sarduy, probablemente por problemas de salud ya no tendría ocasión de desarrollar grandes proyectos, pero aun así crea la Nouvelle Croix du Sud (1991-1995), que venía a revitalizar la Croix du Sud (1952-1970) iniciada por Roger Callois (1913-1978) a su regreso de Argentina.

A fines de los ochenta, Sarduy estaba ya muy enfermo y le era muy difícil llevar adelante el proyecto. Su idea era sin embargo original: la Nueva Cruz del Sur debía ser como una meta-colección que releyera críticamente, a veinte años de intervalo, la colección de Caillois. Por un lado, Sarduy pretendía poner en tela de juicio el aspecto pedagógico del latinoamericanismo de Caillois (habría que recordar que la colección de Caillois publicaba a la vez ensayos culturales sobre América Latina y novelas que debían ilustrar las realidades del continente); por otro, Sarduy aspiraba a ampliar y a actualizar la percepción que se podía tener de la literatura latinoamericana en Francia en aquel momento, editando autores anteriores o posteriores al boom, como Macedonio Fernández y César Aira, como Leopoldo Marechal y Luis Rafael Sánchez.

En 1990, cuando Sarduy deja le Seuil por Gallimard, me pide que ocupe el lugar de lector principal en su nuevo equipo. Así llego a Gallimard. Mi papel fue, en un comienzo, el del lector que debía ir buscando a los nuevos autores, pero la enfermedad de Sarduy hizo que la gestión del proyecto fuera cada vez más difícil dentro del equipo y que la nueva colección no consiguiera afirmarse como una propuesta viable. Cuando en 1993 muere Sarduy, aún quedan algunos títulos por publicar y hay que ocuparse de ellos. Mi intención era editar esos títulos pendientes y luego marcharme a los Estados Unidos, a seguir una carrera universitaria allí. Ese fue el plan hasta que, en 1996, Antoine Gallimard me encargó la gestión editorial de toda el área iberoamericana en la colección Du Monde Entier.

nouvellecroixdusud

Un ejemplo de la Nouvelle Croix du Sud.

Con antecedentes tan ilustres en el cargo, como Valéry Larbaud, Héctor Bianciotti, Caillois o Sarduy, su legado en Gallimard debía de resultar de entrada un poco intimidatorio o imponía un nivel de exigencia bastante alto en cuanto a la literatura americana en español, ¿no? ¿Qué sesgo nuevo pretendías darle o cuál era tu intención respecto de las letras en lengua española en Gallimard?

Digamos que las cosas se fueron haciendo gradualmente, lo que les quitó peso y presión. Además, no eran ya los mismos tiempos ni los mismos públicos, ni tampoco la misma editorial. El fracaso de la Nueva Cruz del Sur me sirvió para entender que ya no se podía seguir defendiendo el principio de una colección latinoamericana al margen de las colecciones generales de literaturas extranjeras, como Du Monde Entier. Había que partir del fondo excepcional de autores iberoamericanos que teníamos (y tenemos) en esa colección y pensar una política destinada a preservarlo, renovarlo y ampliarlo. Preservarlo significaba entonces (y significa ahora) conservar dentro de la casa a los autores principales del catálogo: Borges, Cortázar, Onetti, Cabrera Infante, Paz, Fuentes, Vargas Llosa… Había que seguir publicando sus obras y garantizarles una presencia continua. Esa fue mi primera línea de trabajo.

Luego, estaba (y está) la segunda: la renovación del fondo a través de nuevas traducciones de algunos clásicos, como Rulfo, por ejemplo, o Josep Pla. Se trataba (se trata) de transformar en ventaja lo que es un problema para el editor de literatura extranjera: el envejecimiento acelerado de las traducciones.

En fin, la tercera línea de mi trabajo editorial fue (y es) la ampliación del fondo con la incorporación de dos tipos de autores: los ya altamente consagrados y canónicos, como Ricardo Piglia, Javier Marías o Sergio Pitol, y las figuras más recientes que son objeto de un cierto consenso crítico, como Yuri Herrera, Hernán Ronsino, Rodrigo Blanco Calderón y Samantha Schweblin, para citar solo a los más recientes.

cailloisocampo

Roger Caillois y Silvina Ocampo (1903-1993).

¿La reivindicación que a menudo se hace de España como puente entre la creación latinoamericana y los mercados europeos, que en relación a lo que conocemos como el boom quizá sea menos controvertido, hasta qué punto se corresponde, históricamente, con la realidad o es una exageración? ¿Cómo ha sido, históricamente, la relación entre los escritores en español y los lectores franceses?

La relación con el público francés es una vieja y buena relación, que se ha ido renovando a través de los años. Los autores de lengua española se traducen, se editan y son muy leídos dentro de un cierto sector del mercado que no se puede comparar con el de los autores anglos, claro, pero que está lejos de ser insignificante.

Sobre el papel de España como puente hacia los mercados europeos y la verdadera historia del boom, habría que matizar mucho e investigar más. Creo que se ha exagerado demasiado. El boom fue un fenómeno complejo y global en el que no hubo un solo actor sino varios. Y el protagonismo entre distintas plazas (Buenos Aires, México, La Habana, Barcelona, Paris) fue compartido. Hoy la situación también se hace cada vez más compleja y global, pues ya España no tiene el monopolio de la venta de los derechos de traducción de autores latinoamericanos, ni París es ya la única vitrina de la literatura mundial. Tanto el capital simbólico como el capital económico están más dispersos y la producción de valor, a nivel global, se ha fragmentado y atomizado. Es más difícil llegar a consensos críticos. Mira, si no, las interminables y dispares listas con que la prensa internacional nos castiga cada fin de año en París, Barcelona, Buenos Aires, Nueva York, México o Madrid.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

De izquierda a derecha: Castellet, García Márquez, Barral, Vargas Llosa, Félix de Azúa, Salvador Clotas, Cortázar y García Hortelano.

En el caso del boom, se asume a menudo que el espacio clave es Barcelona, y la agencia de Carmen Balcells en particular, para su internacionalización. Pero parece lógico pensar que sin traducciones podría haber quedado circunscrito al ámbito hispanohablante, y no fue el caso. ¿Qué pesa más en esa internacionalización, el hecho de que autores como Cortázar residan en París o la existencia de una larga tradición de relaciones entre Latinoamérica y Francia, quizá peor conocida? ¿Qué papel atribuyes en ello a Carmen Balcells?

Carmen Balcells transformó la venta de derechos de traducción en un negocio global. Su modelo fue el del marchant d’art que se implicaba en la vida y la obra de los artistas que representaba y los acompañaba en su aventura creativa. En este sentido, era una mujer notabilísima, que respetaba a sus autores, los conocía y conocía la literatura cuyos derechos de traducción negociaba. Ahora bien, sin el contexto internacional que trajo consigo la Revolución Cubana, sin la potencia y la experiencia del polo editorial de Buenos Aires (ahí estaban Sudamericana, Losada y tantas otras casas), sin las traducciones de la colección de Roger Caillois (que circulaban por toda Europa y llegaban a los Estados Unidos), sin Carlos Barral y sus premios, y en fin… sin tantos otros factores, como el genio de Cortázar, García Márquez y Vargas Llosa, sin todo esto no habría habido ningún boom. Así que no exageremos tanto, por mucho que queramos a Carmen y que nos guste Barcelona.

castelletvalverdepetitbarralvseix

De izquierda a derecha: Castellet, José M. Valverde, Joan Petit, Barral y Víctor Seix.

Lo que sí habría que subrayar es que Carmen, como la mayoría de las agentes españolas, era ante todo una gran lectora de sus autores, los conocía y conocía perfectamente sus obras, y cuando hablaba con un editor extranjero, sabía de qué le estaba hablando y sabían también con quién estaba hablando. Por encima de todo, era una mujer que conocía y amaba la literatura que se escribe en español en las dos orillas de la lengua. No siempre es el caso hoy, ya que la venta de derechos está a veces en manos de agentes que no leen el español ni saben nada de sus literaturas ni se interesan de veras en nuestros escritores; o solo saben hablar de su potencial comercial.

Posteriormente, enterrado ya Franco, París volvió a ser un núcleo de difusión importante en relación a la promoción de escritores españoles como Muñoz Molina (n. 1956), Julio Llamazares (n. 1955), Juan José Millás (n. 1952), Javier Marías (n. 1952), Luis Landero (n. 1948), etc., ¿no?

Rafael Conte (1935-2009).

Es cierto. Allá por los ochenta, cuando trabajaba en le Seuil, la promoción de la nueva ola española fue una de nuestras prioridades. Rafael Conte, amigo de la casa, hizo mucho por ellos. También José Miguel Ullán. Recuerdo el lanzamiento de las novelas de Eduardo Mendoza, o de los libros de la cuentista Cristina Fernández Cubas en París. Fue un gran momento de la narrativa española en Francia. Y creo que tuvo repercusiones en toda Europa, ciertamente.

 

En el caso de la literatura catalana, lo habitual es ampliar los lectores mediante la traducción primero al español, pero no fue ese el caso de Joan Sales y su Incerta glòria, cuya primera traducción fue la de Bernard Lesfargues al francés como Gloire incertaine en 1962 (la española, de Carlos Pujol, tuvo que esperar hasta 1969), pero que gracias a que apareció en una editorial como Gallimard luego fue contratada enseguida en otros países. Hay una vocación explícita, parece, de actuar desde Gallimard como puente entre culturas a través de las traducciones, ¿no es así?

Pascale Casanova habla en su libro La République Mondiale des Lettres (1998) del «efecto París», para referirse al impacto simbólico que supone, a un nivel internacional, la traducción al francés de un autor extranjero. No sé si todavía París tiene esa potestad, pero tradicionalmente las traducciones que publica Gallimard sí han tenido ese efecto canónico, un suplemento evaluativo reconocido por premios internacionales como el Nobel. La correspondencia de Caillois con muchos editores extranjeros constituye un registro de este modo de circulación de las traducciones francesas y de la atención que se les prestaba, que aún se les presta, a nivel internacional.

En la misma colección donde Gallimard sitúa, por ejemplo, las obras de Sándor Márai, Pasternak, Faulkner o Kundera, Du Monde Entier, puede encontrarse el Cahier gris de Josep Pla, Frémisante mémoire de Jesús Moncada, La place du Diamant, de Mercè Rodoreda. Y el tándem Ramón Chao-Serge Mestre ha traducido directamente del gallego varias obras de Manuel Rivas en diversas colecciones de Gallimard, que al parecer han sido en general bien acogidas. ¿Estas obras en otras lenguas peninsulares, llegan a Gallimard a través de traducciones previas al español, o hay una mirada puesta en el canon y las novedades de las literaturas gallega y catalana?

salesgallimard1962Sí se les ha dado una atención especial a las lenguas de la Península. Manuel Rivas se traduce en Gallimard directamente del gallego, como Moncada y Pla del catalán. Desde 1996 he tratado de tener siempre en mi equipo lectores de las diversas lenguas peninsulares y también de portugués, por supuesto. Rivas y Pla, entre otros, han sido acogidos con bastante éxito. De hecho, una de las aventuras editoriales más felices de estos últimos años fue la traducción integral del Quadern Gris, que solo se conocía en francés en una versión fragmentaria y muy reducida. Pla faltaba en el catálogo de Gallimard y traerlo fue como cumplir con una deuda pendiente para con un autor tan excepcional y tan francófilo. Sueño con traducir un día sus libros de vagabundeos gastronómicos.

Hay una impresión bastante generalizada de que en Francia hay un mayor reconocimiento hacia la labor del traductor, ¿responde eso a la realidad y, en tal caso, a qué lo atribuyes? Podría sorprender que en las traducciones francesas suele indicarse en los créditos si la traducción es del español de Chile, de Argentina, de Colombia o de México, ¿cómo encaja eso con la pretendida unidad de la lengua española?

Los traductores franceses han sostenido durante muchos años un largo combate para que se reconozcan sus derechos. Hoy se les tiende a considerar cada vez más como re-escritores y por ende como co-creadores de la obra que traducen. De ahí que su nombre aparezca sistemáticamente junto al del autor en las portadillas y los créditos. Me parece más que justo. Necesario.

También era justo y necesario hacerle un lugar a las variaciones del español y a los diversos españoles americanos. Siempre se indica en la portada, cuando se traduce del español, si procede de México, Cuba, Chile, etc. La lingüística reconoce la importancia de estas modalidades más allá o más acá de la unidad de la lengua, que es sobre todo un asunto político, no literario ni editorial ni científico.

josephinefelliermarcellinkristevabartheswahlsarduy

De izquierda a derecha: Josephine Fellier, Julia Kristeva, Roland Barthes, François Wahl y Severo Sarduy en los tiempos de Tel Quel.

En tanto que editor, no estrictamente como lector, ¿qué editor o editores te parece que por su modo de enfocar el trabajo, su talante o su obra te han servido de modelos o has aprendido de ellos?

Son muchos y es difícil no ser desagradecido e injusto. Ya te hablé de Sarduy y de Wahl. A ambos les debo una cierta fidelidad a las estéticas y al pensamiento de vanguardia. También los Gallimard han sido un modelo por la manera como reparten el peso entre el valor literario y las expectativas económicas: «encuentre usted buenos libros y el servicio comercial encontrará la forma de venderlos», me dijo Antoine Gallimard en nuestra primera entrevista.

Tendría que citar asimismo a Jorge Herralde por razones semejantes: en medio del huracán neoliberal, entre los noventa y dos mil, la literatura siguió siendo un valor en el catálogo de Anagrama y hoy se puede leer en él una propuesta de escritura/lectura arriesgada, influyente y sólida. No debería olvidar tampoco a los dos Manolos de Pre-Textos, Borrás y Ramírez, que desde Valencia nos siguen dando lo mejor de la poesía y el pensamiento contemporáneo contra viento y marea. Se me ocurren tantos otros nombres de colegas y amigos tan notables y tan diferentes, como Pilar Reyes y Jaume Vallcorba, como Joan Tarrida y Juan Casamayor; de todos ellos he aprendido algo en distintos momentos de estos años.

canagrama

De izquierda a derecha: Gustavo Guerrero, Lali Gubern y Jorge Herralde en la Feria de Frankfurt 2012.

Entre las generaciones más recientes, habría que citar a editores latinoamericanos como Leonora Djament de Eterna Cadencia, Eduardo Rabasa de Sexto Piso o Matías Rivas de la Diego Portales, que asocian la publicación de ensayos de humanidades, teoría y ciencias sociales, con literatura de la más alta exigencia. De hecho, algunas de las voces claves entre las nuevas generaciones de narradores y ensayistas han salido de esos catálogos. Acaso el factor común que los une es una apuesta por la innovación en pos de otro equilibrio entre las dos caras del oficio editorial – la comercial y la intelectual – después de unos años en que parecía que el afán de rentabilidad y los grandes conglomerados lo iban a devorar todo.

Algunos críticos literarios y profesores muy vinculados al sector editorial evitan ejercer la crítica literaria cuando esta puede entrar en conflicto con autores representados, editados o incluso con amigos, y de ahí que sólo reseñen obras de autores que, en ese plano y también en el académico, les quedan lejos. Tú, en cambio, tanto en la Nouvelle Revue Française como en Cuadernos Hispanoamericanos o Letras Libres siempre te has ocupado de las novedades de la literatura hispanoamericana, que ha sido también tu campo preferente tanto en la universidad como en el sector editorial. ¿Cómo se lleva esa cuádruple vertiente de escritor, editor, profesor y crítico literario? ¿No se producen ciertas tensiones en el momento de enjuiciar la obra de autores próximos en alguno de esos sentidos?

Tienes toda la razón. Claro que se produce una cierta tensión cuando se ocupan tantos lugares a la vez en el campo literario y hasta puede haber cierto conflicto de intereses. Esto me ha llevado a reducir drásticamente la publicación de reseñas y artículos de crítica en los últimos años, muy a mi pesar porque llegué a la edición a través de la crítica literaria y porque esa vocación primera sigue siendo con la que más me identifico y la que me ha dado más satisfacciones.

Además, el tener que leer continuamente todo lo que se está publicando dentro de área hispánica suele darte una visión bastante privilegiada de lo que se está escribiendo en un momento dado. Si no he descartado del todo seguir haciendo crítica, es porque, como te decía, veo al acto de editar como una continuación o prolongación del gesto crítico por otras vías: es una propuesta de escritura/lectura que, como la de una reseña o un artículo, puede ser más o menos acertada y recibir una acogida favorable o desfavorable. Por eso a veces me permito escribir sobre los autores que edito, en revistas españolas o latinoamericanas y aun ocurre que los incluya en algún curso o seminario universitario. Es otra manera de publicar y de compartir una propuesta de escritura/lectura. También me permito escribir sobre autores a los que no edito por una razón u otra, pero cuyas obras me interesan o entusiasman.

grupoeds

De izquierda a derecha: Elizardo Martinez (Ediciones El Callejón), Gustavo Guerrero, Leonora Djament (Eterna Cadencia), Juan Casamayor (Paginas de Espuma), Antonio José Ponte (El Diario de Cuba) y Eduardo Rabasa (Sexto Piso), en marzo de 2016

Fuentes adicionales:

Catherine Fel, «Entretien avec Gustavo Guerrero, responsable du domain hispanophone chez Gallimard», Bureau International de L´Édition Française, marzo de 2009.

Gustavo Guerrero «Vivimos una tendencia a la novelización», entrevista en vídeo en Casa América, 7 de octubre de 2011.

guerreroanagrama

Libro con el que Gustavo Guerrero obtuvo el Premio Anagrama de Ensayo 2008.

Gustavo Guerrero, «La mediación editorial, la traducción y la difusión de las literaturas latinoamericanas en Francia: el proyecto Medet-Lat France. 1950-2000», conferencia en el Seminario Internacional Redes públicas, relaciones editoriales. Hacia una historia cultural de la edición iberoamericana, 22 de noviembre de 2016.

María Pizarro Prada, «4 preguntas a Gustavo Guerrero», en el blog de Iberoamericana/Vervuert, 5 de noviembre de 2012.

Susana Reinoso, «Gallimard y los lectores», publicado en Ñ, y en Función Lenguaje (sin indicación de fecha).

Web sobre la historia de Gallimard, de la colección Du Monde Entier y web de Éditions du Seuil.

 

Anuncios

José Corti, editor modélico y personaje literario inolvidable

José Corti: un être rare, inconnu ou presque du grand public.Mais un modèle: l’éditeur qui n’a jamais publié ce qu’il n’aimait pas. Et il n’aimait que l’écriture la plus haute, la création la plus aiguë, la littérature la plus noble.
Gérard Guillot, Le Figaro

 

Que el azar en la historia editorial existe no es ningún secreto. Es más, tiene un papel protagonista en algunos de sus episodios más interesantes.

José Corti.

Fue el caso del descubrimiento de un autor hoy muy apreciado como Julien Gracq (Louis Poirier, 1910-2007), cuya primera narración, Au chateau dArgol (1938), fue rechazada por Gallimard, en una etapa en que esta poderosa editorial se estaba cubriendo de gloria con algunos rechazos sonados (Gide rechazando a Proust, Coupeau vetando a Jean Cocteau, Malraux rechazando la biografía  que Boris Souvarin escribió de Stalin, Benjamin Crémieux desdeñando a Céline…). Sin embargo, Poirier tuvo la enorme suerte de enciontrarse con un editor como José Corti, que se la jugó en serio y que contó este episodio en unas deliciosas pseudomemorias tituladas Souvenirs désordennés: “¿Acaso no es normal rechazar el plato que otro ha devuelto ya a la cocina? El plato que alguien no ha querido probar no es necesariamente malo.”

José Corti (José Corticchiatto, 1895-1984) se había ganado por entonces un exquisito prestigio, pero muy poco dinero. En 1925 se había instalado como librero y ocasional editor en la mítica calle Clichy (número 6) y no tardó en convertirse en una de las piezas fundamentales del triunfo del surrealismo literario al ocuparse de algunas revistas y manifiestos importantes (Le Surréalisme au service de la Revolution, 1930-1933; , así como de las obras de autores como Louis Aragon (La peinture au défi, 1930), André Breton y Paul Élouard (L´Immaculade Conception, 1930), Breton, Élouard y René Char (Ralentir travaux, 1930)  y poco unos años después, ya durante la guerra civil española, Salvador Dalí (Métamorphose de Narcisse, 1937).

André Breton, René Hislum, Louis Aragon y Paul Élouard en 1920.

En aquellos años llega a un punto en que Corti se queda sin liquidez (por su manía de pagar al contado, según explica), pero se ve incapaz de dejar pasar la oportunidad de dar a la imprenta el libro de quien no tardaría en ser conocido como Julien Gracq:

Para decirlo en pocas palabras, me sentía atrapado entre mi deseo de publicar ese libro y la imposibilidad material de hacerlo, por lo que decidí mandar una carta al autor que me dolió mucho tener que escribir, porque podía tomarme por un burdo comerciante de papel impreso. Y la cuestión era, ¿podía él aceptar, contra toda práctica razonable, participar en los gastos de edición?

Poirier (Gracq), no tardó en responder afirmativamente, y en los años sucesivos se convirtió en el puntal que situó a José Corti en el mapa de la edición francesa, componiendo uno de los ejemplos más claros y longevos de la relación de mutua fidelidad entre autor y editor, que se extendió tanto a la obra narrativa como a la ensayística, a la dramática y a la poética: Un beau ténébreux (1945), Libertad grande (1946), André Breton (1948), El rey pescador (1948), La literatura como bluff (1950)… y así hasta el fenomenal y en buena medida inesperado éxito que supuso El mar de las Sirtes (1951), galardonada con el Premio Goncourt (quizá por entonces la más alta distinción que podía obtener una novela), que Gracq ya había anunciado que no aceptaría, alegando que apreciaba su existencia como escritor discreto ajeno a las modas y a la atención mediática. Como es de suponer, eso no hizo más que alentar el escándalo y las diatribas contra lo que, en algunos medios, se consideró un abuso de poder.

Julien Gracq.

El caso Jacq-Corti es además indicativo de la filosofía que marcó ya para siempre el perfil de la casa: apuestas a menudo muy arriesgadas por autores desconocidos que concebían la literatura como un arte en el que la experimentación tiene cabida, por lo que, lógicamente, las primeras ediciones suelen ser de tiradas muy cortas, y apuestas decididas y a menudo sostenidas por esos autores dispuestos a mantener su compromiso con una investigación estética a un a cambio de unas ventas muy exiguas.

Por el camino, antes del Goncourt, Corti había publicado algunos otros libros importantes, como el Lautréamont (1939), de Gaston Bachelard o la edición de Jacques Crépet y Georges Bin de Las flores del mal (1942) de Baudelaire, y sobre todo había vivido muy de cerca los efectos de la Ocupación nazi, ante la cual se convirtió, con las Éditions du Minuit de Jean Bruller y Pierre de Lescure, en la gran editorial de obras clandestinas.

Jean Ballard con Marcel Pagnol, directores de Cahiers du Sud.

La hecatombe llegó, según lo cuenta el propio Corti, cuando en 1944 recibió al escritor Jean Le Lionnais (1901-1984), que llegaba recomendado por el escritor y editor de Les Cahiers du Sud Jean Ballard (1893-1974), y que se instaló en la librería, adonde se hizo mandar el correo y donde recibía a numerosos miembros de la Resistencia, lo que despertó la malsana curiosidad de la Gestapo. Poco después, tras ser sometido Le Lionnais a tortura, el episodio se saldó con la detención de la esposa de Conti (que al final de la guerra consiguió regresar a París tras pasar por los campos de trabajos forzados alemanes) y de su hijo Dominique Cortichiatto, de diecinueve años, que tras su paso por la prisión de Fresnes fue deportado a un campo de exterminio del que nunca regresó. En una excelente novela (Lutetia) cuya publicación en España ha anunciado la editorial Navona en el momento de escribir estas líneas, el crítico literario y escritor Pierre Assouline ha recreado de forma espléndida la angustia de Corti en su búsqueda desesperada de su familia al término de la guerra, con lo que inmortalizó a un editor del mejor modo que cabe imaginar, convirtiéndolo en un espléndido personaje literario.

Nota de octubre de 2015: Navona Editorial acaba de publicar la traducción de Susana Peralta de la obra de Pierre Assouline con el título Hotel Lutetia.

 

Fuentes:

La web de José Corti, aquí.

Pierre Assouline, Gaston Gallimard. Medio siglo de edición francesa, Valencia, Edicions Alfons el Magnànim (Debats 3), 1987.

Pierre Assouline, Lutetia, París, Gallimard, 2005.

José Corti, Souvenirs désordennés, París, José Corti, 1983.

Los derechos de autor en la Rusia soviética y la rocambolesca Operación Pasternak

Boris Pasternak.

La situación legal de los derechos de autor en la antigua URSS a mediados del siglo XX es un aspecto de la mayor importancia para entender el célebre y rocambolesco caso de la publicación en Occidente de la famosísima obra de Boris Pasternak (1890-1960) El doctor Zhivago, uno de los mayores best séllers literarios del siglo pasado. Explica en buena medida la urgencia y las prisas que tiñeron todo el proceso de edición de un texto que el autor no daba por definitivo.

Puesto que la URRS no había firmado el Convenio de Berna que regulaba los derechos sobre obras literarias, se daba el caso de que en Europa y América, las obras rusas pasaban a dominio público transcurridos treinta días, treinta, desde el momento de su publicación en Rusia, salvo en el caso de que alguna editorial occidental las publicara en ese período, pues entonces la editorial en cuestión podía arrogarse esos derechos.

Giangiacomo Feltrinelli.

El genial y asombroso editor italiano Giangiacomo Feltrinelli (1926-1972) sabía muy bien lo que se hacía cuando en el invierno de 1955 aceptó a la propuesta de Sergio D´Angelo (director de la librería del Partido Comunista Italiano) de hacer labores de scouting para su recién creada editorial con motivo del viaje que D´Angelo se disponía a emprender para incorporarse a Radio Moscú. Lo que es más difícil que imaginara es la brillante perla que D´Angelo pondría en manos del más comunista de los editores italianos de la época.

El propio Feltrinelli habló y escribió en más de una ocasión acerca de la publicación de la exitosa novela de Pasternak, quizá por primera vez por extenso en el artículo que publicó The Sunday Times el 31 de mayo de 1970. Cuando el texto de la obra había empezado a circular en algunos medios rusos, pero nadie se atrevía a publicarlo, D´Angelo visitó a Pasternak para pedirle la obra, y éste, al entregársela le espetó: “Queda usted invitado a partir de este momento a mi fusilamiento”. Pasternak sabía bien cómo se estaban poniendo y cuán volátiles eran las cosas para los intelectuales tras la muerte de Stalin. Una vez estuvo en su poder, una de las primeras cosas que hizo Feltrinelli fue pedir un rápido informe sobre la obra a Pietro Antonio Zveteremich, cuya sentencia tampoco tiene desperdicio: “No publicar una novela como esta constituye un crimen contra la cultura”.

A partir sobre todo de las cartas cruzadas entre Pasternak y Feltrinelli entre junio de 1956 y noviembre de 1957, Carlo Feltrinelli hace una reconstrucción del trompicado proceso de edición de la novela, que de pronto el autor considera como errónea por estar trabajando en un manuscrito que no da por definitivo, de repente la censura rusa duda acerca de si conviene o no publicarla, y en el que tienen también un papel las duras presiones que, a través del Partido Comunista Italiano, las autoridades rusas ejercen sobre Feltrinelli para evitar que lleve a cabo la publicación de una obra que, en palabras del ministro de Asuntos Exteriores Dimitri Spilov, constituye “un feroz libelo contra la URSS”. En Rusia El doctor Zhivago no se publicó hasta la perestroika, entre enero y abril de 1988, y curiosamente por la misma revista (Novy Mir) que en su momento la rechazó. ¿Un acto de justicia poética? En cualquier caso, vale la pena volver al libro de Carlo Feltrinelli para seguir ese proceso, pero el caso es que finalmente la traducción italiana apareció el 22 noviembre 1957.

Paralelamente, a través de los servicios secretos británicos (el MI6), la CIA estaba haciendo cuanto estaba en su mano para conseguir que la obra se publicara en ruso, simulando una edición hecha en la URSS, y para ello contaron con el buen hacer de la editorial holandesa especializada en edición de facsímiles Mouton.

A las puertas del invierno de 1956, un avión fue desviado “por razones técnicas” de su trayecto entre Roma y Milán para aterrizar en Malta. Dos hombres entraron en la bodega, abrieron una maleta, extrajeron de ella un enorme manuscrito y lo retuvieron en una sala del aeropuerto durante dos horas, tras lo cual el avión reanudó su viaje. Para entonces, el texto había sido fotografiado página a página y, una vez convertido en microfilm, fue mandado a la CIA. Su intención última, al parecer, era promover el Premio Nobel para Pasternak, cosa muy difícil si la obra, que chocaba en Rusia con la censura ideológica, no se publicaba en su lengua original. Para ello, la Mouton se ocupó de encontrar papel igual al empleado habitualmente en las pequeñas ediciones rusas y hacer una edición imitando en todo lo posible las de ese país. Un ejemplar de esa edición “pirata” puede verse en el Museo de la CIA en Langley, Virginia (y en su web).

Edición en Feltrinelli.

 

Unos centenares de esos ejemplares fueron regalados a los visitantes de la Exposición General de primera categoría de Bruselas que se celebró entre el 6 julio y el 29 septiembre 1958, en el stand de Ciudad del Vaticano, que se encontraba justo enfrente del ruso y que, por gentileza del Louvre, exponía como gran atractivo El Pensador de Rodin. Esos ejemplares, a los que los visitantes sacaban las cubiertas azules para facilitar su entrada en Rusia (se han documentado casos incluso en que se ocultaron las páginas entre las de libros de partituras), fueron las primeras que llegaron al país natal del escritor, donde fueron profusamente difundidas mediante copia y préstamo.

Brice Parain.

A Francia esta obra de Pasternak llegó por intermediación de Brice Parain, encargado de literatura rusa en Gallimard (y profesor de filosofía de Jean-Luc Goddard), que conocía al autor desde la década de los veinte (estaba casado con una rusa, gran amiga de la primera esposa de Pasternak). El 30 de diciembre de 1956, comprometida ya la traducción italiana, está fechada la carta en que el autor expresa a Parain su deseo de ver en una editorial del prestigio cultural de Gallimard su novela. La encargada de hacer llegar una copia del texto a Parain, el 20 de enero siguiente, fue la condesa Jacqueline de Proyart (n. 1927), conservadora del Museo Tolstói de París que durante un intercambio como estudiante en Moscú entabló una firme amistad con Pasternak que la llevó a convertirse en representante del autor en Francia, además de ser una de las traductoras de la obra (con Michel Aucouturier, Louis Martínez y Hélène Peltier-Zamyska), si bien firmada bajo seudónimo colectivo para proteger sus relaciones con las instituciones culturales rusas. En junio de 1958 se ponía ya a la venta esta edición parisina en la colección Du Monde Entier.

Ediciíon en Gallimard.

La traducción al francés, lengua que Pasternak dominaba (y que empleaba por ejemplo en sus relaciones epistolares con Feltrinelli), era de enorme importancia, pues debía convertirse en el texto canónico a partir del cual debía pasar a otras lenguas, siempre que fuera imposible la traducción directa del ruso, y la versión de Gallimard le hizo exclamar:

Quel style, quel rythme ! Est-ce une syntaxe, un mode littéraire ? Non c’est une procession des choses passées réellement, la marche des années, des amours, des désastres, lente, grave, mesurée (et on tourne les pages), sainte, solennelle. Ô mes chers, ô mes chers ! Et je pleure et pleure. Quelle est la traduction ? Y suis-je un juge admissible ? Nullement. [carta de Pasternak a Proyat del 18 de agosto de 1958, reproducida en Lettres a mes amies françaises (1955-1960), París, Gallimard, 1994]

La primera traducción directa del ruso al español la debemos a Marta Rebón, publicada en noviembre de 2010 en Círculo de Lectores/Galaxia Gutenberg, aunque, salvo error, la primera edición en publicarse fue la de Ediciones Minerva de Uruguay, en traducción de

J. Lluís Monreal.

Vicente Oliva, a la que siguió en Noguer, como número 155 de la colección Galería Literaria, la traducción firmada por el incombustible Fernando Gutiérrez, hecha a partir de la primera traducción italiana. Sin embargo, respecto a la traducción española es interesante el testimonio del gran editor y fundador del grupo Océano Josep Lluís Monreal (n. 1931), quien por aquellos años, siendo empleado de Josep Janés, se vio en la tesitura de evaluar la oportunidad de contratar la voluminosa obra de Pasternak con destino al mercado español. Así lo contó:

Llegaron [sic] a España un barco con parte de los niños que se habían refugiado en Rusia durante la guerra civil y entonces ya eran adultos. Nosotros contratamos a uno de estos hombres, una persona muy culta, que nos hizo la traducción de este libro que circulaba de forma clandestina por Rusia. Se tradujo parte del libro al español y yo lo encontré aburrido y lo rechacé. Si se volviera a repetir la situación volvería a decir no. Pasternak fue un gran poeta, pero la novela no era su fuerte.

Fuentes:

Pierre Assouline, Gaston Gallimard. Medio siglo de edición francesa, traducción de Ana Montero Bosch y prólogo de Rafael Conte, València, Edicions Alfons el Magnànim (Debates 3), 1987.

Carlo Feltrinelli, Senior Service. Biografía de un editor, traducción de Mercedes Corral, Barcelona, Tusquets Editores (Tiempo de Memoria 12), 2001.

Éditions Gallimard, Le docteur Jivago de Boris Pasternak, web de la editorial, que incluye citas, cartas de Pasternak a su representante en Francia (y cotraductora) documentos y un relato pormenorizado del proceso de contratación y traducción de la obra.

Josep Lluís Monreal-Silvia Lluís Rovira, conversación reproducida en Felicidad Orquín, ed., Conversaciones con editores: en primera persona, Madrid, Siruela, 2007, pp. 35-63.

Carles Santamaría, “Josep Lluis Monreal. A la recerca de nous horitzons editorials”, en Noms per a una historia de l´edició a Catalunya, Barcelona, Gremi d´Editors de Catalunya, 2001, pp. 41-80.

Iván Tosltói, La novela blanqueada. El Doctior Zhivago de Pasternak entre el KGB y la CIA, traducción de Joaquín Fernández-Valdés Roig-Gironella, Barcelona, Galaxia Gutenberg, 2014.

Documentos desclasificados de la CIA sobre el caso Pasternak, aquí.

Vinyoli & Viñoly, traduttore, traditore (malgré lui?)

Joan Vinyoli

NOTA IMPRESCINDIBLE (ABRIL DE 2016): En el apartado Comentarios se revisan algunos de los datos ofrecidos en su momento en este texto de enero de 2014, y que condicionan buena parte de su sentido.

Es lógico y justo que las conmemoraciones del centenario de Joan Vinyoli (1914-1984) se concentren sobre todo en su obra poética, porque se cuenta entre las más importantes que ha dado la literatura catalana del siglo xx. Sin embargo, no es en absoluto desdeñable su impresionante trayectoria como editor y, en menor medida, su obra como traductor al catalán y al español también tiene puntos de interés.

Al tratar este último aspecto de la obra de Vinyoli suele mencionarse y ponderarse sobre todo la calidad de sus traducciones de Rainer Maria Rilke al catalán: Versions de Rilke (Proa, 1984) y, póstumamente, en edición de Xavier Folch y Feliu Formosa, Noves versions de Rilke (Empúries, 1985), que obviamente firmaba con su nombre. Pero rara vez se aborda su ingente producción como traductor al español, que, si bien variada, es particularmente cuantiosa en el ámbito de la novela policíaca que publicó Barral Editores a principios de la década de 1970. (Ver, sin embargo, Comentarios)

Sin embargo, ya durante la guerra había participado como cotraductor, al español, con Ernesto Martínez Ferrando y José María Quiroga, en la Historia de la literatura. Maravillosa síntesis de historia universal, de Klabund (Arthur Henschke, 1890-1928), firmando “Juan Viñoly”, y con el mismo nombre, ya en la posguerra, Aquí debieran florecer rosas, del autor danés Jens Peter Jacobsen (1847-1885), en la colección Euro de José Janés y Félix Ros.

Aun así, en los primeros años de la década de 1970 y coincidiendo con una etapa muy difícil en la editorial en que trabajaba (Labor), aparece el grueso de su producción como traductor, que se prolongará más allá del año de su jubilación como director editorial (1979). En 1971 se publica en Seix Barral, firmada por Juan Viñoly y José Elías, la traducción de Las guerrilleras, de Monique Witting; en la misma editorial, en 1973, aparece Lectura de Brecht, de Bernard Dort, y en la Serie Negra de Barral Editores se publican en 1973 sus traducciones de La hermana pequeña, de Raymond Chandler (número 18); Las princesas de Acapulco, de Giorgio Scerbanenco (número 20); Max y los chatarreros (en colaboración con Josep Elías), de Claude Néron (núm. 23); Sinfonía para una masacre, de Alain Reynaud-Fourton (núm. 36) Tierra al asunto, de Jean Laborde (núm. 37) y El traficante de cadáveres, de Dominique Fabre (núm. 38). Poco después traduciría también a Céline (Casse-Pipe. Conversaciones con el profesor Y), a Josep Pla (Vida de Manolo contrada por él mismo), la antología de Van Hageland Las mejores historias de fantasmas y toda una serie de traducciones pro pane lucrando (Carlos Semprún Maura, Dominique Cacoub, Aldo Rizzo, Philippe de Jonas, etc.).

Dado que Vinyoli no se jubiló de Labor hasta 1979, cabe suponer que el grueso de estas traducciones, y en particular las que hizo para su amigo Carlos Barral, las compaginaba además con su jornada laboral, lo cual hace doblemente increíble la prodigalidad de Vinyoli (o Viñoly) como traductor.

De izquierda a derecha, Carlos Barral, Max Aub y Carlos Fuentes.

Los valiosísimos estudios que Daniel Linder ha dedicado a las traducciones en España de los clásicos de la novela negra dan algunas pistas para entender semejante rapidez. En un trabajo dedicado a la novela de Chandler The Big Sleep, por ejemplo, Linde establece la siguiente concatenación de traducciones:

  1. 1949: Con el título Una dama tenebrosa, en traducción firmada por el prolífico Juan G. de Luaces y publicada en Mateu.
  2. 1957: El mismo texto y la misma firma con el título Una mujer en la sombra, en Mateu de nuevo.
  3. 1958: Entre las Novelas Escogidas de Chandler, en traducción firmada por Inés Navarro y Antonio Gómez, en Aguilar. Inés Navarro era secretaria ejecutiva en Aguilar y Antonio Gómez su marido. Pese a no ser traductores profesionales, llevan su firma muchos de los títulos de series como las del inspector Maigret o las de Fantomas, por ejemplo.
  4. 1972: Como El sueño eterno, en traducción de un inexistente José Antonio Lara (¿una broma antiPlanetaria?), en Barral Editores, cuyo texto es el de Navarro-Gómez “maquillado”, es decir con cambios de estilo.

Bastará este ejemplo para advertir la escasa consideración que tenía Barral hacia la novela policíaca, y la cosa quizá no tendría mayor trascendencia si ese mismo texto no hubiera tenido más de una veintena de reimpresiones y de ediciones en Bruguera, Planeta y RBA, entre otras.

Acerca del Chandler que tradujo Vinyoli, evidentemente del francés, vale la pena remontarse a los antecedentes de ese original. Como es bien sabido, al término de la Segunda Guerra Mundial, Marcel Duhamel fundó en el seno de la editorial Gallimard la célebre colección de novela policíaca Serie Noire, y, para acomodarse a 180 o 240 páginas como máximo, decidió suprimir de las novelas estadounidenses todo lo que fuera psicología o no contribuyera a hacer avanzar la acción. Era además una práctica común en esos años de escasez de papel, y en un artículo también muy recomendable Jerôme Dupuis cuantifica los cortes a menudo en un 25 % del original o, en el caso de Cible mouvante, de Ross Macdonald (en Presses de la Cité) en un tercio del original. Más sangrante incluso es el caso de Dead Weight, de Frank Kane, de la que se publicó con el título Envoyé, c´est pesé! una versión en  la que los crueles chinos rojos del argumento original se habían convertido en los buenos y los simpáticos chinos nacionalistas en tipos deleznables. Tal despropósito parecería proceder de un fervoroso comunista, pero es que tras el Luc-Paul Dael que firmaba la traducción se ocultaba ni más ni menos que Paul Claudel (1868-1955).

Como es fácil suponer a estas alturas del texto, efectivamente, el Raymond Chandler que firmó Vinyoli lo tradujo a partir una edición muy incompleta, mutilada, que había publicado Gallimard con el título Fais pas ta rosière! (1950), traducida por Simone Jacquemont y J. G. Marquet. Y en sus excelentes trabajos Linder señala tanto la atenuación que Viñoly lleva a cabo de los pasajes de lenguaje demasiado crudo o de tema sexual (sin duda para evitar la censura franquista), como los errores en que incurre al traducir del francés. Ello lleva indefectiblemente a pensar en cuántas novelas negras publicadas en España en esa época presentarán, además de los efectos de la censura, ese mismo problema derivado del uso de traducciones-puente. En el caso concreto de La hermana pequeña, esa misma traducción mutilada que tradujo Viñoly tuvo además varias ediciones en Bruguera, Orbis y Plaza & Janés, hasta que en 1995 Juan Manuel Ibeas Delgado corrigió esa traducción y restituyó los pasajes suprimidos para la edición de Debate.

Fuentes:

Jérôme Dupuis, “Romans americains, la traduction était trop courte”, L´Express, 24 de octubre de 2012.

Daniel Linder, The American Detective Novel in Translation. The translations of Raymond Chandler´s novels in Spanish, tesis doctoral, Universidad de Salamanca, 2008.

Daniel Linder, “Classic Chandler translations published by Barral Editores (Barcelona)“, 1611. Revista d´Història de la Traducció, núm. 5.

Daniel Linder, “The Censorship of Sex: A Study of Raymond Chandl er’sThe Big Sleep in Franco’s Spain”, TTR (Traduction, terminologie, redaction) vol. 17, numero 1 (1er semestre de 2004), pp. 155-182.

Wollanup, “Raymnond Chandler, les enquêtes de Philip Marlowe“, Moonwalker.

Jusep Torres Campalans, de Max Aub. Portadas

A Nora Grosse, con admiración y agradecimiento.

FCE (Tezontle), 1958.

FCE (Tezontle), 1958.

Sin ánimo de ser exhaustivo, un recorrido por sólo algunas de las portadas que ha tenido en sus distintas ediciones el Jusep Torres Campalans de Max Aub da cuenta, de un modo correlativo, de la distinta consideración que ha tenido este libro y de las diversas interpretaciones que se le han dado como obra artística: desde una inicial y generalmente respetuosa, en la que se reproducía la obra en su integridad (encuadernación, maquetación, ilustraciones, etc.), tal como Max Aub la había ideado y concebido, hasta la publicación fragmentaria (caso particularmente del Cuaderno Verde, del que hay también versión en epub) o incluso en compañía de otra obra, esta puramente narrativa, supuestamente afín (Dos vidas imaginarias).

Galllimard (nrf), 1961.

Galllimard (nrf), 1961.

Tras la primera edición en la colección del Fondo de Cultura Económica Tezontle (1958), que combina dos muestras del estilo artístico del propio Jusep Torres Campalans (1886-¿1956?), tanto la primera edición de Gallimard (1961) como la primera de Doubleday (1962), si bien en cuanto al interior, número de ilustraciones, reproducciones a color, maquetación (pese a los cambios obligados por la traducción), etc., se mantienen relativamente fieles a la de Tezontle –probablemente porque estuvieron sujetas a la aprobación del autor–, ambas optan por una imagen de cubierta distinta, pero por supuesto también obra del genial pintor catalán, y es lógico deducir que el motivo de este cambio es no romper con las respectivas líneas de diseño de portadas que tenían las colecciones en que se publicó; es decir, el diseño de la cubierta se adaptó al de las colecciones respectivas.

Mondadori

Mondadori (Quaderni della Medusa), 1963.

En cuanto a la primera edición italiana, en la que aparecen ya sólo seis ilustraciones interiores a color, como número 18 de los célebres Quaderni della Medusa de Mondadori (1963),  aún se hace más evidente la influencia del diseño de la colección en el hecho de que no aparezca como ilustración de portada una obra pictórica de Torres Campalans. El estilo sobrio y elegante que caracteriza los libros de la Medusa se impone al título en particular.

De 1970 es la primera edición española, como número 64 de la colección dirgida por Antonio Vilanova Palabra en el Tiempo (Lumen), y que, ajustándose al diseño de la colección, un poco a la manera de Gallimard, reproduce una obra de Campalans, Ocaso ¿1909-1910? (34 x 22,5 cm), de la que en el catálogo elaborado por Henry Richard Town con que se cierra la obra se dice:

Papel de plata, acuarela, guache sobre cartón. Uno de los pocos cuadros horizontales de J. T. C., en contra de su teoría acerca de la “necesaria verticalidad” de los mismos. Una de las pinturas más famosas, por haber dado al collage un sentido oscuro y poético distinto al que, por esa época, empezaron a emplear Braque y Picasso. Resuelve, con pan de oro, el Sol que, en este caso, es la Luna y, con un trozo de papel de plata, al firmamento. La trágica oscuridad del cielo, la profundidad dada a la tierra con puros sienas, el dramático efecto del horizonte, lejanísimo, explican la celebridad que tuvo entre los pocos, y buenos, que lo conocieron.

El hecho de que no esté firmado ha inducido a Florent Raynouart a dudar de su autenticidad. Como dijo Martin Chausson-Rochefort, que conoció el cuadro sin saber quién era su autor (N.R.F., junio, 1921): “El hecho mismo del ocaso, siempre misterioso en sus resultados para el hombre, deja su sedimento en quien ha visto alguna vez la que yo califico de obra maestra de ese misterioso pintor” “La profundaidada de tierra y cielo es sobrenatural, metafísica. La luz el horizonte anuncia un nuevo mundo” Propiedad dde F.G. de los R. [¿Francisco Giner de los Ríos?]

Lumen (Palabra en el tiempo), 1970.

Lumen (Palabra en el tiempo), 1970.

Resulta curioso que, siendo una edición de la que tanto Aub como su agente Carmen Balcells podían estar muy pendientes, se haya suprimido toda reproducción a color (mientras que hay encartes en papel satinado con reproducciones a toda página en blanco y negro), pero ya se ve de buenas a primeras qué algo anda torcido en esta portada observando la imagen y cotejándola con el texto reproducido anteriormente. No hace falta constancia documental ninguna (que quizás exista en la Fundación Max Aub), de que el autor no aprobó la prueba definitiva de portada, me parece que es algo impensable que hiciera cosa semejante, a no ser que pretendiera dar una vuelta de tuerca más a la ya de por sí muy retorcida broma que es el Jusep Torres Campalans. El hecho de que escribiera el texto de solapa, supuestamente para aclarar el carácter ficticio o real de la obra (cosa que en realidad no hace, sino que añade más confusión), avalaría la segunda hipótesis. Me parece evidente que el cuadro de Campalans en cuestión no sólo aparece invertido (el sol debería estar en el lado derecho), sino que, además, boca abajo.

Alianza (El Libro de Bolsillo), 1975.

Alianza (El Libro de Bolsillo), 1975.

La portada de la siguiente edición española, la de Alianza Editorial publicada en 1975, es ya una edición en bolsillo y que por consiguiente, sin analizar siquiera el interior, no respeta la integridad de la obra –si convenimos que por “obra” en este caso debemos entender algo que va bastante más allá del texto–, pero aun así, circunscribiéndonos al tema de la portada, tiene el innegable acierto de elegir como imagen para de este libro el cuadro Elegante, fechado en 1912, que es descrito en el interior del libro como  un óleo sobre cartón de 35 x 26 cm y que se caracteriza como un  “Gracioso divertimento cubista, en honor de Toulouse-Lautrec. Propiedad de A.M.L.”. No se me ocurre nada mejor que un “gracioso divertimento cubista” para ilustrar el Jusep Torres Campalans aubiano. Es una verdadera lástima en esta edición, además, que se haya plegado a la tipografía (y cuerpo de la misma) y al interlineado menos favorecedor de esta colección, que en esos aspectos muestra una cierta flexibilidad.

Plaza & Janés (Biblioteca Letras del Exilio), 1985.

Plaza & Janés (Biblioteca Letras del Exilio), 1985.

Las restricciones impuestas por el diseño de la colección, que resulta evidente, no parece justificación satisfactoria para explicar una muy inadecuada portada de Plaza & Janés en su Biblioteca Letras del Exilio, publicada en 1985 para un libro como el de Max Aub. A partir de la única foto de Jusep Torres Campalans, en compañía de Pablo Ruiz, obra según se dice de José Renau y tomada en Barcelona en 1912 (¿en Els Quatre Gats, quizá?), se ha creado para esta portada una ilustración a dos tintas que muy poco tiene que ver con el estilo que caracterizó las diversas etapas de Jusep Torres Campalans.  Quizás hubiera sido más lógico hacer una excepción en este caso y mirar a la edición original aubiana en lugar de ajustarse a los parámetros de la colección.

Sellerio, 1992.

Sellerio, 1992.

El Bodegón, de 1910 (49 x 32 cm), creación en la que Torres Campalans combina acuarela, guache y óleo, es el cuadro que eligió Sellerio para su portada, cuadro acerca del que se especifica en el texto: “Sin duda, influencia de Matisse. Pero los objetos, colocados alrededor del gran copón azul y gris plomo, dan relente religioso a la cruda fuerza de los colores. Propiedad de Juan Ribadell y Closas.” Realmente, a ningún conocedor de Torres Campalans escapará que se trata de una de las obras más miméticas de Campalans, que casi parece un estudio de las técnicas pictóricas de Matisse, y aplicada además a uno de sus temas más recurrentes. El lector menos avezado incluso podría tomarlo por un plagio. Y poco más o menos podría decirse de portada de la edición de Piper (1999), reproducida entre las fuentes.

Eichborn, 1995.

Eichborn, 1995.

La portada de Gatza/Eichborn en la edición de 1995 resulta muy interesante porque recupera otro de los cuadros menos conocidos hasta entonces pero muy impactantes, de Campalans, el Retrato de Rainer María Rilke, 1913 (25 x 18 cm), óleo y guache. “J.T.C. emplea aquí –explica el texto aubiano–métodos abandonados (sombras rayadas grosso modo) y adopta, al mismo tiempo, otros que hallarían gloria con el expresionismo alemán. El resultado es sorprendente. Con el tiempo ha perdido brillantez.” Resulta un tanto asombroso que se atribuya la propiedad de esta obra a un muy poco conocido Museo Rilke, donde quizá se podría apreciar hasta qué punto ese deterioro, esa pérdida de la brillantez, de ha acentuado.

Más difícil es todavía conseguir ver al natural el cuadro que empleó Eichborn en la edición de 1997 para ilustrar esa misma portada, el Retrato corto de Picasso, 1912 (26 x 18 cm), fechado en 1912, y según se informa propiedad de Verlag Robert Richter Büchergilde Frankfurt Wien o.J.Pablo Picasso. En balde se buscará en los museos Picasso de Málaga, Barcelona o París. “Este retrato de gran vigor, al igual que el Retrato de hombre de la misma fecha –según la descripción de Aub–, está pintado con una técnica que no me atrevo a catalogar. Tinta china, lápices de color, desde luego; los ojos, esmaltados. ¿Pero los “bajos fondos”?.

Finalmente, Destino, al plantearse su edición del Jusep Torres Campalans, tuvo el buen sentido de hacer una edición facsímil de la de Tezontle, la creación original de Aub, quien no escribió un libro (cosa imposible, por otra parte), sino que diseñó un libro de cabo a rabo (texto incluido).

 Fuentes:

Ana Calvo Revilla, “Ficción y realidad en Jusep Torres Campalans, de Max Aub“, Entresiglos.

Dolores Fernández, La imagen literaria del artista de vanguardia en el siglo XX: Jusep Torres Campalans, tesis doctoral dirigida por Francisco Calvo Serraller, Universidad Complutense de Madrid, diciembre de 1993.

Dolores Fernández, La leyenda de Jusep Torres Campalans”, en Cecilio Alonso, ed.,Max Aub y el Laberinto español, Valencia, 1996, vol. II, pp. 825-858.

Dolores Fernández, “Arte y literatura en Max Aub”, Turia, núm. 43-44 (marzo de 1998), pp. 146-159.

Dolores Fernández, “Imagen visual y literaria de la mujer vanguardista“, El Correo de Euclides, núm. 1 (2006), pp. 255-267.

Piper (1999).

Piper (1999).

Estelle Irizarry, La broma literaria en nuestros días. Max Aub, Francisco Ayala, Ricardo Gullón, Carlos Ripoll, César Tiempo, Nueva York, Eliseo Torres and Sons (Torres Library of Literary Studies 31), 1979.

Max Aub” en Manuel Aznar Soler, dir., Diccionario bio-bibliográfico de los escritores del exilio republicano de 1939.

Gérard Malgat, “Max Aub y André Malraux: retrato de una amistad en el espejo de la historia”, El Correo de Euclides, núm. 1 (2006), pp. 176-187.

Javier Quiñones, De ahora en adelante.

Antonio Saura, “El pintor imaginario”, en Ignacio Soldevila y Dolores Fernandez, Max Aub, veinticinco años después, Madrid, Editorial Complutense, 1999, pp. 91-110.

Ignacio Soldevila Durante, La obra narrativa de Max Aub, Madrid, Gredos (Biblioteca Románica Hispánica 189), 1973.

María de los Ángeles Valls Vicente, “Las versiones ilustradas de la obra de Max Aub”,El Correo de Euclides, núm. 4 (2009), pp. 88-99.

Cuaderno Verde (Sirpus, 2007)

Dos vida imaginarias (RBA, 2011)

Jusep Torres Campalans, de Max Aub. Génesis

A Javier Quiñones, autor de Max Aub, novela.

Parece haber un acuerdo bastante amplio en que Jusep Torres Campalans (1958) es, si no la mejor, una de las mejores obras de Max Aub y de las que mejor han resistido el paso del tiempo. Se han esgrimido muy diversas razones, con razón, para defender esta tesis. Esta espléndida y elaboradísima broma literaria consistente en biografiar a un pintor catalán amigo de Picasso, creando toda la parafernalia propia de este tipo de textos (cronología, relato fragmentario y con lagunas de la vida, retazos de testimonios de primera mano, de textos alusivos, catálogo minucioso y detallado de las obras pictóricas, reproducción de algunas de las mismas, notas bibliográficas, etc.) constituye, por lo que yo sé, uno de los juegos más asombrosos, divertidos, ingeniosos y geniales que habrá dado la cultura española, y exponer la obra pictórica en algunas de las ciudades más importantes del planeta (México, Nueva York, París…) fue ya la guinda.

El editor Albert Skira fotografiado hacia 1938 o 1939 por el gran Gyula Halász (1899-1984), más conocido como Brasaï, a quien Henry Miller describió como “El Ojo de París” y que es autor además de unas interesantes Conversations avec Picasso publicadas en 1964 por Gallimard (en español, coeditadas por el Fondo de Cultura Económica y Turner en 2002).

Pese a la abundante bibliografía que ha generado el Jusep Torres Campalans, sin embargo, creo que no se ha resaltado lo suficiente que Max Aub, aparte de una novela que es una biografía ficticia con voluntad de invadir el espacio no ficcional, lo que concibió sobre todo es un libro, un libro que, si bien se pueden alegar otros modelos (Dolores Fernández menciona L´art abstrait de Michel Seuphor publicado en París por Maeght en 1950), toma como base los célebres volúmenes de la colección Le Goût de Notre Temps que publicaba primero en Lausana y luego en Génova Albert Skira (Albert Schira, 1904-1973) , quien en los años treinta había publicado a Picasso (las Métamorphoses de Ovidio), Matisse (Poèsies de Mallarmé) o Dalí (Les chants de Maldoror de Lautréamont) y en los cuarenta varias obras con textos de André Malraux (detalle no menor en relación al contexto de Campalans). Si Skira podía hacer libros tan magníficos a unos precios tan ajustados, ¿por qué no iba a poder hacer lo mismo el Fondo de Cultura Económica en la colección Tezontle?

Portada del Picasso de la colección Le Goût de Notre Temps (conocidos popularmente como “los pequeños Skira”). Son volúmenes encuadernados en tapa dura con sobrecubiertas, de unos 17 x 18 cm, y por tanto más manejables que los libros de arte al uso (eso contribuye a explicar su éxito) y que rondan las 150 páginas. A finales de los sesenta Carrogio los empezó a publicar en español.

La primera mención del libro quizá sea la que aparece con fecha del 9 de agosto de 1955 en los diarios personales de Max Aub, donde tras la rotunda afirmación “Nace Jusep Torres Campalans” y lo que podría ser un índice sintético de la biografía, se añade:

Escribirlo todo como una biografía “acerca de…”

Entrevista. Vida (falsa).

Estética (falsa), y -sólo Cugh- la historia.

Publicarlo como una monografía, con reproducciones.

Casi exactamente dos años después (el 20 de septiembre de 1957), escribe en carta a Ignacio Soldevila: “Ayer le puse punto final a mi Jusep Torres Campalans y hoy le escribo”. Probablemente, a la vista de la fecha de publicación de la obra (junio de 1958), lo más acertado sea suponer que en esta carta Max Aub se refiere a la conclusión de la escritura del texto, no a la corrección de pruebas, porque además en carta a Vicente Aleixandre del 8 de abril de 1958, escribe:

Dentro de un mes, o dos, saldrá otra [obra] que supongo que te divertirá: he inventado un pintor, compañero de Picasso, la he escrito como una de esas monografías de Skira -hice todos los dibujos. Los pintores van a pegar un respingo. Se lo merecen: hablo de los que imitan, de los que se copian unos a otros. Cada día odio más lo falso. Y tenemos tanto que contar todavía (ojalá fuese en todos los sentidos).

Este texto, añadido a la coincidencia de la encuadernación en tela con sobrecubierta en papel satinado o detalles como la situación del folio al pie, deja muy claro cuál es el modelo, por lo menos consciente, y la diferencia en el formato es probable que tenga una explicación en la dificultad para encontrar en México un formato de papel adecuado a un precio razonable. Antes, sin embargo, Aub había hecho el 29 de abril una anotación en su diario que tiene que ver mucho con este libro: “Definición del arte: hacer de la mentira verdad”.

Max Aub, su esposa Peua Barjau e Ignacio Soldevila en Québec.

Harto de ver cómo la censura franquista venía poniendo impedimentos a su obra, en este libro tiene puestas sus ilusiones, como explica a Francisco Fernández Santos: “Tengo la esperanza de que el libro pueda venderse, sin obstáculos, en España. Ha de armar, sin duda, cierto revuelo”. De hecho, al poco de salir la edición mexicana, que en palabras de Dolores Fernández “sale al mercado acompañado de un gran aparato publicitario protagonizado sobre todo por el [periódico] Excélsior, que comienza anunciándolo el día antes (1 de junio), subrayando el descubrimiento de Max Aub (28 de junio). El 2 de julio anuncia la exposición que tendrá lugar por la tarde”, en agosto de 1958 se presenta por primera vez un fragmento de esta obra en las páginas de la revista de Camilo José Cela Papeles de Son Armadans, en diciembre de ese año se publica una interesante reseña de Eusebio García Luengo en Índice, así como una carta de Vicente Aleixandre referente al Campalans en la prestigiosa revista Ínsula, entre otros comentarios. Sin embargo, quizá fuese la salida de Joaquín Díez Canedo del FCE y la creación en 1962 de la editorial Joaquín Mortiz lo que contribuyó a retrasar la distribución no clandestina de este libro en España, de la que se hizo cargo Seix Barral y que en 1965 editó un folleto alusivo a la obra, además de ocuparse de que se reactivara la presencia de alusiones al Jusep Torres Campalans en la prensa.

El diseñador gráfico Robert Massin ante su mesa de trabajo en Gallimard cubierta de diseños de la celebérrima colección Folio.

Antes de la llegada más o menos normal del libro a España, sin embargo, había aparecido ya la versión francesa en la influyente Gallimard (en traducción de Alice y Pierre Gaspar), por imposición del amigo de Aub (y desde julio de 1959 ministro de Asuntos Culturales con De Gaulle) André Malraux. Según contaba en abril de 1998 el artista gráfico y tipógrafo Massin (Robert Massin, n. 1925) a Gérard Malgat: 

Fue Malraux quien impuso a Gallimard el libro de Max, no cabe duda. Pues a Gaston Gallimard no le gustaban para nada los libros ilustrados: solo le interesaban la literatura y los textos […] De hecho, la colección L´Univers de les Formes estuvo a punto de no publicarse en Gallimard ya que Gaston arrastraba los pies y Claude también: no querían. Aplazaban lo más posible su decisión.

Para el lanzamiento del libro, Aub pasa varios meses en París, y el año siguiente, coincidiendo con la publicación en Doubleday de la traducción estadounidense  (de Herbert Weinstock), se dedica a pintar nuevos cuadros y organiza una nueva exposición, en la neoyorquina Badley Gallery de Jusep Torres Campalans que permanece abierta desde el 29 de octubre hasta el 19 de noviembre. Del 28 de mayo de 1963 es el colofón de la edición italiana, publicada por de nuevo por otra editorial importante, Mondadori, en traducción de Giuseppe Ciontioli, quien añade un prólogo sobre la traducción. En este caso, el señuelo es la prepublicación de un fragmento en La Nazione del 30 de abril acompañada de un comentario del traductor. (La edición alemana se hizo esperar mucho, pero de nuevo corrió  a cargo de una empresa influyente, Eichborn, que publicó la traducción de Albrecht Buschmann y Eugene Helmé en 1995, precedida de una presentación de Mercedes Figueras.)

Portada de las Novelas escogidas de Max Aub en la colección Tolle, Lege de Aguilar.

Entre la salida de la edición italiana y la publicación de la española, Max Aub había pasado a ser representado por Carmen Balcells (por un contrato de diciembre de 1964), que fue la responsable de la contratación por parte de Lumen, que la publicó en la colección Palabra en el Tiempo que dirigía Antonio Vilanova. El mismo año se incluía en las Novelas escogidas de Max Aub que publicaba la Aguilar mexicana (en pp. 635-929). Y a estas seguirían las de Alianza en bolsillo en 1975, Plaza & Janés en Letras del Exilio en 1985 (en rústica) o la de Destino de 1999, que, con muy buen tino, recupera las características de la de Tezontle y restituía por tanto los pasajes censurados en las ediciones españolas publicadas hasta entonces.

Max Aub no sólo bromeaba. Su pasión por las artes del libro venía de muy lejos, de los años viente y treinta, y uno de los valores de su Jusep Torres Campalans es su belleza como libro, como obra artística, en la que Aub tuvo una participación indudable como creador, pues tenía muy claro qué libro pretendía hacer y cómo. De ahí que pueda considerarse que publicarlo con las imágenes en blanco y negro, en formato de bolsillo o con un papel que transparenta los dibujos, con márgenes estéticamente inaceptables, etc., sea desvirtuar la obra de Max Aub. Aspectos (no pocos) como el hecho de que la portada de la edición de Lumen reproduzca mal (invertido) un cuadro de Campalans merecen comentario aparte.

Placa conmemorativa del nacimiento en París de Max Aub (en cité de Trevise, 3). “En este inmueble nació el 2 de junio de 1903 Max Aub, escritor español, novelista, dramaturgo, ensayista. En 1942, después de haber estado varias veces en campos de internamiento en Vernet d´Ariège y Djelfa, se exilió en México, donde murió el 22 de julio de 1972”. Wikipedia Commons / Mu

Fuentes:

Max Aub, Epistolario del exilio (1940-1972), Ayuntamiento de Segorbe, 1992.

Carmen Balcells, “Testimonio personal”, en El Correo de Euclides, núm. 6 (2011), p. 96.

Ana Calvo Revilla, “Ficción y realidad en Jusep Torres Campalans, de Max Aub“, Entresiglos.

Dolores Fernández, La imagen literaria del artista de vanguardia en el siglo XX: Jusep Torres Campalans, tesis doctoral dirigida por Francisco Calvo Serraller, Universidad Complutense de Madrid, diciembre de 1993.

Dolores Fernández, La leyenda de Jusep Torres Campalans”, en Cecilio Alonso, ed., Max Aub y el Laberinto español, Valencia, 1996, vol. II, pp. 825-858.

Dolores Fernández, “Arte y literatura en Max Aub”, Turia, núm. 43-44 (marzo de 1998), pp. 146-159.

Dolores Fernández, “Imagen visual y literaria de la mujer vanguardista“, El Correo de Euclides, núm. 1 (2006), pp. 255-267.

Estelle Irizarry, La broma literaria en nuestros días. Max Aub, Francisco Ayala, Ricardo Gullón, Carlos Ripoll, César Tiempo, Nueva York, Eliseo Torres and Sons (Torres Library of Literary Studies 31), 1979.

Max Aub” en Manuel Aznar Soler, dir., Diccionario bio-bibliográfico de los escritores del exilio republicano de 1939.

Gérard Malgat, “Max Aub y André Malraux: retrato de una amistad en el espejo de la historia”, El Correo de Euclides, núm. 1 (2006), pp. 176-187.

Javier Quiñones, De ahora en adelante.

Jesús Sánchez Zapatero, “Lo que importa es España: proyectos para la recuperación editorial en el epistolario entre Max Aub y Carmen Balcells (1964-1972)”, El Correo de Euclides, núm. 6 (2011), pp- 33-48.

Antonio Saura, “El pintor imaginario”, en Ignacio Soldevila y Dolores Fernandez, Max Aub, veinticinco años después, Madrid, Editorial Complutense, 1999, pp. 91-110.

Ignacio Soldevila Durante, La obra narrativa de Max Aub, Madrid, Gredos (Biblioteca Románica Hispánica 189), 1973.

María de los Ángeles Valls Vicente, “Las versiones ilustradas de la obra de Max Aub”, El Correo de Euclides, núm. 4 (2009), pp. 88-99.