Métailié y la divulgación de la literatura latinoamericana en Europa

No hay duda de que Francia, y en particular París, ha sido desde hace por lo menos un siglo uno de los mayores y más importantes centros de irradiación de la literatura en lengua española. Basten para demostrarlo la trascendencia que tuvo esa ciudad en el hecho de que se hicieran un nombre en el ámbito de la edición internacional escritores como José María Vargas Vila (1860-1933), Rubén Darío (1867-1916), Amado Nervo (1870-1919), Enrique Gómez Carrillo (1873-1927), Victoria Ocampo (1890-1979), Vicente Huidobro (1893-1948), Miguel Ángel Asturias (1899-1974), Alejo Carpentier (1904-1980), Alfredo Gangotena (1904-1944), Julio Cortázar (1914-1984), Elena Garro (1916-1998), Julio Ramón Ribeyro (1929-1994), Héctor Bianciotti (1930-2012), Severo Sarduy (1937-1993)…

Logo conmemorativo de los primeros cuarenta años de la editorial, con su característica salamandra, símbolo, al decir de Anne Marie Métailié, de la pasión incombustible.

En las últimas décadas, y si bien, como dice Gustavo Guerrero, «tanto el capital simbólico como el capital económico están más dispersos y la producción de valor, a nivel global, se ha fragmentado y atomizado», no hay duda de que una de las editoriales que ejerce más conscientemente esa función irradiadora ha sido Éditions Métailié, fundada en 1979 por Anne-Marie Métailié, una estudiante de origen pied noir que, quizá no casualmente, tras formarse en ciencias políticas y en lengua y literatura española y portuguesa, había colaborado con Alain Touraine (n.2915) y Pierre Bordieu (1930-2002) en la Maison des Sciences de l’Homme.

De hecho, como ha contado en diversas ocasiones, la vocación de Anne-Marie Métailié se forjó como consecuencia de esa colaboración, concretamente realizando un estudio sobre el papel del editor en el campo cultural: «Me encontré con Jérôme Lindon, director de Éditions de Minuit, y me impresionó la extraordinaria forma en que hablaba de libros. Me quise reconocer en un trabajo como el de este hombre». Acaso su siguiente contacto con el mundo editorial fuera ya la traducción al francés, con Gérard Bessière, de una antología del poeta nicaragüense Ernesto Cardenal publicada por la histórica editorial dominica Éditions du Cerf en 1974.

Anne-Marie Métailié.

Sin embargo, en esos años, aunque muchos puestos subalternos los ocupaban mujeres, había en Francia solo otra editorial importante a cuyo frente estuviera una mujer, Régine Desforgues (cuya editorial L’Or du Temps se estrenó con Le Con d’Irene, de Luis Aragon, y por el que fue condenada a cinco años de pérdida de derechos civiles por «ultraje a las buenas costumbres»). Eso contribuye a explicar la anécdota que Métailié contó al periodista Pablo del Llano acerca de sus inicios:

En el 79, cuando abrió su editorial, un día [Anne-Marie Métailié] fue a ver al dueño del mejor taller gráfico de París. Un anciano de 85 años que se desplazaba por la ciudad en un Rolls Royce blanco. Le acompañó su marido. Cuando llegaron, el señor del taller se dirigió al hombre para empezar a hablar de negocios, pero él le dijo: «Yo soy el chófer, la editora es mi esposa». Entonces el viejo del Rolls blanco llamó a su mujer: «Querida, haz el favor de atender a esta señorita».

En su discurso de recepción del Premio al Mérito Editorial de la Feria Internacional del Libro de Guadalajara, en 2014, la editora completó esa misma anécdota dotándola de un matiz un poco distinto acerca del lugar de las mujeres en el sistema editorial de aquellos años en Francia: «el director llamó a su esposa para negociar conmigo, y ella me dijo: “somos pocas mujeres en el oficio, le voy a poner buenas condiciones para pagar, pero, por favor, no me defraude”».

Contando con el capital suficiente para poder publicar tres libros, la editorial se estrenó con una obra bastante asombrosa que había sido un gran éxito de ventas cuando se publicó por primera vez, en 1557, Nus, féroces et antropophages (traducido en español como Verdadera historia y descripción de un país de salvajes desnudos, feroces y caníbales situado en el Nuevo Mundo), en el que el soldado y marinero alemán Hans Staden (1525-1579) narra por primera vez el encuentro con un pueblo caníbal, en este caso los tupinambas brasileños, del que estuvo preso durante nueve meses hasta que finalmente logró escapar. Sin embargo, la tirada inicial que se hizo de la edición francesa (3.000 ejemplares) tardaría veinte años en agotarse.

No obstante, quizá no sea este un título muy representativo de los primeros años del catálogo de Métailié, que inicialmente pone de manifiesto el interés de su directora por divulgar las ciencias humanas en un estilo accesible a todos los públicos en las colecciones Traversées, dirigida por el etnólogo Pascal Dibié (n. 1949), y Leçons des Choses, dirigida al principio por el historiador y sociólogo Michel Pollak (1948-1992) y luego por el sociólogo, poeta y cineasta Luc Boltanski (n. 1940). En estas colecciones se ha publicado el grueso de la obra del sociólogo David Le Breton, así como títulos de Nietzsche, H.G. Wells, Michel Butor y Louis Pinto, entre otros muchos.

Sin embargo, sobre todo a principios de los años ochenta, progresivamente fue ganando terreno la literatura de ficción traducida, consecuente tanto con la voluntad de la editora de atenuar los efectos de la colonización cultural angloamericana como con su conocimiento y aprecio de la literatura latinoamericana, si bien Métailié lo ha atribuido también a la necesidad de mantener la solvencia económica de la editorial, así como al descubrimiento de que el trato con los escritores de ficción le resultaba menos rígido y más agradable que, en general, el de los académicos. La preferencia por la narrativa sobre todo latinoamericana (e inicialmente en lengua portuguesa) ha quedado también adecuadamente explicada:

Cuando tomé esa decisión, todo el mundo me decía que la literatura latinoamericana estaba muerta. […] esto me llevó a pensar que todos los jóvenes con los que había hecho campaña contra las dictaduras de América Latina, que soñaban con ser poetas, que tenían que huir, que habían sido encarcelados y muchos de ellos habían tenido que exiliarse, inevitablemente se despertarían un día u otro y volverían a la literatura, que habían tenido que abandonar. Y no me equivoqué.

Aun así, el primer beneficiado de este cambio de orientación editorial fue la obra narrativa de Machado de Asís (1839-1908), cuyas traducciones al francés, al decir de la editora, habían envejecido muy mal. Sin embargo, el primer éxito de ventas de una cierta importancia en el campo de la literatura llegó, ciertamente, un poco inesperadamente de la mano de la recuperación de un prolífico novelista italiano, Luigi Natoli (1857-1941), de quien publicó primero La bâtard de Palerme (Histoire des Beati Paoli) (1990), donde se cuentan los orígenes de la mafia siciliana, y al que siguieron, los otros dos volúmenes del ciclo Histoire des Beati Paoli: La mort à Messine (1991) y Coroliano (1991).

La segunda mitad de la década de los ochenta fueron tiempos difíciles desde el punto de vista financiero, hasta el punto que José Saramago  (a quien en 1982 había publicado Memorial do Convento) abandonó en 1986 la editorial (ganaría el Nobel en 1998), y poco tiempo después Lobo Antunes siguió sus pasos para regresar a su anterior editor francés, Christian Bougois.

El libro que permitió a Métailié saldar las deudas acumuladas y alcanzar una cierta estabilidad económica tras una década bregando con las estrecheces sí fue muy representativo de ese interés por la narrativa latinoamericana postboom, Un viejo que leía novelas de amor, del chileno Luis Sepúlveda, quien desde entonces ha publicado toda su obra en francés en Métailié, si bien hasta que no hubo vendido más de 36.000 ejemplares Le vieux qui lisait des romans d’amour (1992) no empezó a despertar el interés de la crítica de actualidad francesa (y posteriormente ganó el Premio France Culture a la mejor novela extranjera). Su éxito, pues, se forjó en el boca-oreja y, sobre todo, a través de la complicidad con los libreros. Además, Sepúlveda le dio a conocer a otros autores que pasarían a engrosar el catálogo de Métailié e incluso a ser parte importante del mismo, como es particularmente el caso de Paco Ignacio Taibo II, por ejemplo.

Progresivamente Métailié publicaría a Selva Almada, José María Arguedas, Bryce Echenique, Horacio Castellanos Moya, Santiago Gamboa, Rafael Gumucio, Sylvia Iparraguirre, Lídia Jorge, Miguel Littin, Maitena, Elmer Mendoza, Rosa Montero, Elsa Osorio, Sergio Ramírez, Leonardo Padura, Rafael Reig, José Luis Sampedro, Santiago Roncagliolo, Juana Salabert, Karla Suárez, Dalton Trevisan… Aun así, los latinoamericanos no suponen ni la tercera parte de los nombres del catálogo, y como regla general Métailié procura fidelizar y retener a sus autores para poder publicarles así el grueso de su obra.

Al final de la década siguiente, con las finanzas ya saneadas y la voluntad de asegurar la continuidad de la editorial y dejar de frecuentar a los banqueros, en 2009 vendió el 85% de la empresa a Éditions du Seuil, con la que sea había asociado ya en 1991 para la distribución. Así lo explicaba en el citado discurso: «Elegí asociarme con Le Seuil porque son editores, tienen una cultura editorial y no hacen como los grupos que compran para echar a la calle a los editores y remplazarlos con contables, eliminando así todo margen de riesgo, pero eliminando así también la suerte».

Casi inmediatamente después de cerrar el trato con Seuil (en 2010) contrataba a la editora Lise Belperron (a quien se atribuyen los descubrimientos, por ejemplo, del nigeriano Leye Adenle en la agencia Van Aggelen y, en el catálogo de Pontas Agency, la india Shubhangi Swarup). Además, en el momento en que cumple cuarenta años de labor editorial, cuenta entre sus colaboradores con Nicole Barry, para el ámbito de la lengua alemana, Keith Dixon, para la escocesa, Serge Quadruppani para la italiana y Pierre Léglise-Costa para el ámbito portugués, mientras que de la literatura brasileña, a día de hoy, sigue ocupándose personalmente Anne-Marie Métailié.

Fuentes:

Web de Éditions Métailié

Michel Bertrand y Richard Marin, «Regard d’un éditeur sur la production littérairelatino-américaniste» (entrevista a Anne-Marie Métailié), Caravelle, núm. 100 (2013), pp. 101-117.

Claude Combet, «J’ai le syndrome des oeuvres completes» (entrevista a Anne-Marie Métailié), Livres Hebdo, 8 de febrero de 2019, pp. 34-36.

Manuela Corigliano, «Entrevista a Anne-Marie Métailié» (vídeo), en Manuela&Co, 21 de noviembre de 2019.

Astrid Éliard, «Anne-Marie Métailié, la passioné», Le Figaro, 28 de julio de 2008.

Tina García, «Entrevista a Anne-Marie Métailié, editora (Éditions Métailié)», Ah Magazine, 23 de octubre de 2014.

Marie Françoise Govin, «Anne-Marie Métailié, éditrice à la salamandre», Mediapart, 19 de abril de 2018.

Pablo del Llano, «Anne-Marie Métailié: “El premio Nobel entierra al escritor» (entrevista), El País, 30 de diciembre de 2014.

Anne-Marie Métailié, «30 ans», en la web de Éditions Métailié.

—, Discurso de aceptación del Premio al Mérito Editorial de la Feria Internacional del Libro de Guadalajara 2014.

Liza Pulecio, «La politique éditoriale de Métailié:”Pour nous ouvrir le monde passionnément», Monde du Livre, 20 de julio de 2013.

Pierre Bourdieu, editor: rigor clásico y audacia vanguardista

La obra ensayística del sociólogo Pierre Bourdieu (1930-2002) es sin duda una de las más conocidas e influyentes de las últimas décadas en el ámbito de las ciencias humanas. Sin embargo, y pese a su labor con el historiador Fernand Braudel (1902-1985) al frente de la original revista Actes de la Recherche en Sciences Sociales, menos conocida es en general su trayectoria como editor y particularmente como director de colecciones cuya incidencia ha extendido mucho más allá de los límites de la vida cultural francesa.

Pierre Bourdieu.

Como director de la colección Le Sens Commun, creada por él mismo en el seno de las exquisitas Éditions de Minuit, desde 1966 y hasta 1991 dio a conocer a un público amplio el trabajo de investigación y ensayístico de algunos filósofos, sociólogos, antropólogos y escritores importantes, tanto clásicos como menos reputados hasta entonces, como son los casos de Marcel Mauss, Emile Benveniste (Vocabulaire des institutions indo-européennes), Ernst Cassirer (La Philosophie des formes symboliques), Emile Durkheim, Mijaíl Bajtín, Edward Sapir, Joseph Schumpeter, Ervin Goffman, John Searle, Theodor Adorno, Erwin Panofsky o Luis Prieto (Pertinence et pratique. Essai de sémiologie), entre otros muchos, además de ir dando a imprenta algunos de los títulos importantes de su propia obra (L’amour de l’art, 1966; La distinction, 1979; Le Sens pratique, 1980; Questions de sociologie, 1980; Homo academicus, 1984; La noblesse de l’État, 1989, etc.).

Sin embargo, mientras tanto se había convertido en 1975 en editor consultor de la American Journal of Sociology y ese mismo año había puesto en marcha (en el seno de la Maison des Sciences de l’Homme) la ya mencionada revista Actes (ARSS), en cuyo consejo científico figuraban reputadísimos historiadores (Quentin Skinner, Roger Chartier, Robert Darnton, Eric Hobsbawm), filósofos (Jacques Bouveresse, Anne Fagot-Largeault), sociólogos (Christian Baudelot, Aaron Cicourel, Yves Gingras), antropólogos (Alban Bensa), juristas (Mireille Delmas-Marty), etc. El enorme impacto inicial de las Actes de la Recherche en Sciences Sociales se basó, tratándose de contenido de gran rigor científico, en el gran formato, la maquetación y el potente apoyo visual general (incorporación de numerosas ilustraciones e incluso de cómics). Pero en el ámbito de la edición tuvo un gran impacto el número temático de marzo de 1999 («Édition, éditeurs 1»), que se abría con el texto de Bourdieu «Une révolution conservatrice dans l’edition» (acompañado además de gráficos muy ilustrativos sobre la situación del panorama editorial francés y un utilísimo anexo informativo) y proseguía con textos de Jean-Yoves Molier (acreca la edición francesa entre el XVIII y el XX), Diana Cooper Richet (sobre las librerías extranjeras en París), los obstáculos para la investigación  de las estrategias editoriales), Anne-Marie Thiesse y Natalia Chmatko (los nuevos editores rusos), Gustavo Sorá (la evolución editorial brasileña)…, número que Jorge Herralde glosa en Por orden alfabético.

La continuación(«Édition, éditeurs 2») aparecería en diciembre de ese mismo año con no menos interesantes textos de Benedicte Reynaud («L’emprise des groupes»), Olivier Godechot («Le marché du libre philosophique»), Claudia Schalke y Markus Gerlach («Le paysage éditorial allemand») y André Schiffrin (sobre las editoriales universitarias estadounidenses), entre otros.

A partir de 1989 había empezado a salir, también en Éditions de Minuit y dirigida por Bordieu, Liber: Revue européenne des livres (subtitulada Revue internationale des livres desde junio de 1994), que al poco tiempo y hasta 1998 se convierte en suplemento de las Actes.

Aun así, cuando a principios de los años noventa Pierre Bourdieu había empezado a publicar su propia obra en las Editions du Seuil –donde arrancó con un título tan emblemático como Les règles de l’art: genèse et structure du champ littéraire (1992) –, sin abandonar los proyectos ya en marcha añadió a estos la fundación y dirección de la colección Liber, donde en 1996 publica su famoso Sur la televisión suivi de L’emprise du journalisme, y dos años después el no menos difundido La domination masculine. Como empresa destinada a la publicación de libros, Liber se había constituido en 1996 (a rebufo del movimientos social y huelguístico del año anterior contra el plan Juppé) como una asociación según la ley de 1901 (es decir, sin ánimo de lucro), y a su vez dio pie al nacimiento en 1998 de Attac (Asociación por la Tasación de las Transacciones Financieras y por la Acción Ciudadana), en la que confluyeron desde el músico y activista Manu Chao hasta el filósofo y lingüista Noam Chomsky, pasando por el economista Arcadi Oliveres, el jurista Carlos Jiménez Villarejo o el historiador Éric Toussaint. Quedaba claro que Bourdieu era cualquier cosa menos un académico que solo saliera de su despacho para dirigirse al aula; es más, no estaba dispuesto a que sus alumnos o pupilos constituyeran su único auditorio.

Como editorial al margen de Seuil, Liber inició dos grandes colecciones, Raisons d’Agir (Razones de actuar) y Cours et Travaux (cursos y trabajos), y una tercera de coediciones con editoriales e instituciones diversas (entre ellas Seuil y Collège de France). Jorge Herralde ha descrito el resultado general de esta iniciativa en los siguientes términos: «libros de intervención política y cultural […] Se trataba de libros breves de precio asequible, a menudo de gran difusión, bestsellers alternativos», un género que a finales de la primera década del siglo XXI ha resurgido en España. Al Sur la télévision (1996) le siguieron en Raisons d’Agir títulos del colectivo ARESER (asociación de reflexión sobre la enseñanza superior y la investigación), Loïc Wacquant (Les prisons de la misère, 1999) o Jacques Bouveresse (Prodiges et vertiges de l’analogie, 1999), entre otros, además de los muy famosos y combativos Contre-feux (1998 y 2001), del propio Bourdieu.

Cours et Travaux, por su parte, se abrió también con un texto de Bourdieu (Science de la science et reflexivité, 2001), y se le dio continuidad a menudo con libros colectivos, como son los casos por ejemplo de Le cauchemar de Humboldt, les reformes de l’enseignement supérieur européen, editado por el equipo formado por los sociólogos Franz Schulteis (alemán), Marta Roca i Escoda (catalana) y Paul Frantz Cousin (francés), La protestation étudiante (2009), dirigido por el sociólogo Bertrand Geay o Des littératures combatives, l´Internationale des nationalismes litteraraires (2011), dirigido por la teórica y crítica literaria Pascale Casanova (1959-2018), pupila de Bourdieu y a quien su La République mondiale des lettres había dado amplia reputación y su labor crítica en el programa radiofónico L´Atelier littéraire (en France Culture) una amplia popularidad.

Probablemente este repaso sea suficiente para hacerse una idea de la dimensión de la obra puesta en marcha por Bourdieu en el campo de la edición, destinada sobre todo a hacer accesible al lector común y corriente (y de ingresos modestos) el resultado de una serie de trabajos e investigaciones cuya influencia, pese a su indudable interés social y capacidad de incidencia en la vida política y cultural, a menudo han tendido a quedar muy estrictamente circunscritos al ámbito universitario. Y hacerlo de un modo clarificador, sin perder el paso de la actualidad, capaz de conectar con un público amplio y sin que ello suponga un menoscabo del rigor. Pas mal. Así lo concretó el propio Bourdieu en el texto de presentación de Raisons d’Agir:

Ofrecer los instrumentos de comprensión, es decir de libertad, que genera la investigación internacional en todas sus formas, literaria, científica, reunir sin otros criterios que la calidad, la novedad, el rigor y la originalidad de los trabajos franceses y extranjeros sobre los problemas más complejos y más candentes del pensamiento y la acción, este es el objetivo de esta colección que quisiera aunar la exigencia de un riguroso clasicismo y la audacia de las vanguardias.

Fuentes:

Pierre Bourdieu, un hommage (blog).

Paul Costey, «Pierre Bourdieu, penseur de la pratique», Revue Tracés, núm. 7 (invierno 2004-2005), p. 11-25.

Jorge Herralde, «Pierre Bourdieu, la musculatura intelectual de un luchador», fusión de un artículo publicado en El Periódico en 2002 («Adiós a Bourdieu») y un texto inédito de 2004 («Pierre Bourdieu, editor y funcionario de la humanidad»), recogido en Por orden alfabético. Escritores, editores, amigos, Barcelona, Anagrama (Biblioteca de la Memoria 22), 2006, pp. 47-51.

Michel Winock, El siglo de los intelectuales, traducción de Ana Herrera, Barcelona, Edhasa, 2010.

El acto de editar como acto de escritura/lectura. Entrevista a Gustavo Guerrero

Gustavo Guerrero (Caracas, 1957), profesor universitario, crítico literario y ensayista, escritor y consejero literario para el ámbito de la lengua española en Gallimard, desde hace ya varios años ha asistido desde una posición privilegiada a los procesos de internacionalización de la literatura española y latinoamericana, en los que París ha desempeñado un papel fundamental.

expo-sarduyguerrerowal176

Gustavo Guerrero y el editor François Wahl (1925-2014).

Llegas a París, habiéndote graduado en Derecho en la Universidad Andrés Bello, ¿qué te lleva a París?

En realidad, el viaje a París supuso una ruptura. Durante mis últimos años en Caracas vivía una doble vida: de día era un joven abogado especializado en derecho financiero (trabajaba en la colocación de bonos de la deuda pública en los mercados extranjeros) y de noche escribía reseñas y notas bibliográficas para el suplemento literario del periódico El Universal (por entonces uno de los más importantes de Venezuela) y también para otras publicaciones nacionales y extranjeras (entre ellas, la famosa Vuelta de Octavio Paz). Llegó un momento en que se hizo imposible seguir sirviendo a estas dos coronas.

genette

Gérard Genette (París, 1930).

La Fundación para la Cultura y las Artes de Caracas me ofreció una salida al otorgarme una beca de estudios en teoría y crítica literaria sobre la base de un dosier formado por mis artículos. Así salí de Venezuela y del mundo del derecho; así llegué a París y al departamento de teoría literaria de la Escuela de Altos Estudios en Ciencias Sociales. Pero el derecho y las finanzas no desaparecieron del todo. Han sido, por el contrario, dos herramientas esenciales para ejercer cabalmente el oficio de editor.

Cuando entras en la Escuela de Altos Estudios en Ciencias Sociales, Gerard Genette (n. 1930), que dirigió tanto tu licenciatura como tu doctorado, era ya una estrella de los estudios literarios, pero en 1982, justo cuando tú te diplomas, publica un ensayo tan influyente como el Palimpsestos. ¿Qué puedes contar del Genette profesor y de su influencia sobre tu modo de afrontar la literatura? Porque creo que proponía, sobre todo en Figuras III, un método de análisis de textos literarios muy útil y productivo.

Palimpsestos fue primero un seminario de dos o tres años en la Escuela, y luego una lectura capital. ¿Qué decía Genette en ese libro? Afirmaba que el sentido de una obra literaria no dependía de la sola estructura de su texto (algo que en aquel entonces aún parecía bastante herético) sino que variaba en función del entorno de ese texto y, en particular, de la manera como el objeto libro, a través de sus cubiertas, ilustraciones, cuartas de forro, solapas, etc., trataba de inducir o incluso de imponer una cierta interpretación. Para mí fue el descubrimiento de que el acto editorial podía ser un acto de escritura/lectura que implicaba la imposición de un sentido y secretaba (o trataba de secretar) un horizonte de recepción determinado. Editar era algo más que hacer libros; era conferir un sentido, formular una propuesta de lectura.

¿Cuáles eran tus experiencias editoriales cuando llegas a Gallimard?

logoduseuil

Logo de Éditions du Seuil, obra de Robert Lapoujade, que reproduce su sede entre 1945 y 2010: rue Jacob, 27.

Es una historia un poco larga. Antes de entrar a Gallimard, estuve trabajando durante tres años en Editions du Seuil. Allí me inicié en el oficio, junto a Severo Sarduy y a François Wahl. Todo partió de Genette, que también formaba parte del equipo de le Seuil (por entonces dirigía la colección Poétique). Recuerdo que el tema de mi tesina en la Escuela fue el concepto de neobarroco en la obra de Sarduy. Gracias al apoyo de Andrés Sánchez Robayna, ese trabajito universitario, algo retocado, se editó en Barcelona con el título rimbombante de La estrategia neobarroca (1988). Pero antes de que se publicara, Genette se lo envió al propio Sarduy y éste se lo dio a leer a François Wahl, que era como el gran mandarín de toda el área de humanidades y ciencias sociales en la editorial. Ambos me propusieron que leyera y redactara informes para las colecciones de literatura extranjera.

Fueron unos años inolvidables. Se trabajaba muy a gusto, dentro de un clima de efervescencia, camaradería e informalidad. Todavía soplaban los vientos libertarios del mayo francés por los corredores de la casita de la rue Jacob. Cada libro se leía y se discutía con rigor, con apasionamiento, como si todos participaran en una misma aventura literaria, cultural y política. Redactar un informe era como realizar un ejercicio de crítica en el que se daba por sentado que la responsabilidad de un editor no se limitaba a garantizar un nivel de ventas. Había también una responsabilidad intelectual de saber por qué se hacía lo que se hacía, cómo y para quién. En la rue Jacob aprendí así a redactar informes, cuartas de forro y solapas, comunicados de prensa y hasta documentos comerciales; pero sobre todo a Seuil le debo una idea de lo que significa editar.

croixdusud

Un ejemplo de La Croix du Sud de Caillois: Sécheresse, de Graciliano Ramos.

Tu entrada como director del ámbito de la lengua española en Gallimard se produce en 1996 para sustituir a Severo Sarduy (1937-1993). Por la fecha en que se produce esa llegada de Sarduy, probablemente por problemas de salud ya no tendría ocasión de desarrollar grandes proyectos, pero aun así crea la Nouvelle Croix du Sud (1991-1995), que venía a revitalizar la Croix du Sud (1952-1970) iniciada por Roger Callois (1913-1978) a su regreso de Argentina.

A fines de los ochenta, Sarduy estaba ya muy enfermo y le era muy difícil llevar adelante el proyecto. Su idea era sin embargo original: la Nueva Cruz del Sur debía ser como una meta-colección que releyera críticamente, a veinte años de intervalo, la colección de Caillois. Por un lado, Sarduy pretendía poner en tela de juicio el aspecto pedagógico del latinoamericanismo de Caillois (habría que recordar que la colección de Caillois publicaba a la vez ensayos culturales sobre América Latina y novelas que debían ilustrar las realidades del continente); por otro, Sarduy aspiraba a ampliar y a actualizar la percepción que se podía tener de la literatura latinoamericana en Francia en aquel momento, editando autores anteriores o posteriores al boom, como Macedonio Fernández y César Aira, como Leopoldo Marechal y Luis Rafael Sánchez.

En 1990, cuando Sarduy deja le Seuil por Gallimard, me pide que ocupe el lugar de lector principal en su nuevo equipo. Así llego a Gallimard. Mi papel fue, en un comienzo, el del lector que debía ir buscando a los nuevos autores, pero la enfermedad de Sarduy hizo que la gestión del proyecto fuera cada vez más difícil dentro del equipo y que la nueva colección no consiguiera afirmarse como una propuesta viable. Cuando en 1993 muere Sarduy, aún quedan algunos títulos por publicar y hay que ocuparse de ellos. Mi intención era editar esos títulos pendientes y luego marcharme a los Estados Unidos, a seguir una carrera universitaria allí. Ese fue el plan hasta que, en 1996, Antoine Gallimard me encargó la gestión editorial de toda el área iberoamericana en la colección Du Monde Entier.

nouvellecroixdusud

Un ejemplo de la Nouvelle Croix du Sud.

Con antecedentes tan ilustres en el cargo, como Valéry Larbaud, Héctor Bianciotti, Caillois o Sarduy, su legado en Gallimard debía de resultar de entrada un poco intimidatorio o imponía un nivel de exigencia bastante alto en cuanto a la literatura americana en español, ¿no? ¿Qué sesgo nuevo pretendías darle o cuál era tu intención respecto de las letras en lengua española en Gallimard?

Digamos que las cosas se fueron haciendo gradualmente, lo que les quitó peso y presión. Además, no eran ya los mismos tiempos ni los mismos públicos, ni tampoco la misma editorial. El fracaso de la Nueva Cruz del Sur me sirvió para entender que ya no se podía seguir defendiendo el principio de una colección latinoamericana al margen de las colecciones generales de literaturas extranjeras, como Du Monde Entier. Había que partir del fondo excepcional de autores iberoamericanos que teníamos (y tenemos) en esa colección y pensar una política destinada a preservarlo, renovarlo y ampliarlo. Preservarlo significaba entonces (y significa ahora) conservar dentro de la casa a los autores principales del catálogo: Borges, Cortázar, Onetti, Cabrera Infante, Paz, Fuentes, Vargas Llosa… Había que seguir publicando sus obras y garantizarles una presencia continua. Esa fue mi primera línea de trabajo.

Luego, estaba (y está) la segunda: la renovación del fondo a través de nuevas traducciones de algunos clásicos, como Rulfo, por ejemplo, o Josep Pla. Se trataba (se trata) de transformar en ventaja lo que es un problema para el editor de literatura extranjera: el envejecimiento acelerado de las traducciones.

En fin, la tercera línea de mi trabajo editorial fue (y es) la ampliación del fondo con la incorporación de dos tipos de autores: los ya altamente consagrados y canónicos, como Ricardo Piglia, Javier Marías o Sergio Pitol, y las figuras más recientes que son objeto de un cierto consenso crítico, como Yuri Herrera, Hernán Ronsino, Rodrigo Blanco Calderón y Samantha Schweblin, para citar solo a los más recientes.

cailloisocampo

Roger Caillois y Silvina Ocampo (1903-1993).

¿La reivindicación que a menudo se hace de España como puente entre la creación latinoamericana y los mercados europeos, que en relación a lo que conocemos como el boom quizá sea menos controvertido, hasta qué punto se corresponde, históricamente, con la realidad o es una exageración? ¿Cómo ha sido, históricamente, la relación entre los escritores en español y los lectores franceses?

La relación con el público francés es una vieja y buena relación, que se ha ido renovando a través de los años. Los autores de lengua española se traducen, se editan y son muy leídos dentro de un cierto sector del mercado que no se puede comparar con el de los autores anglos, claro, pero que está lejos de ser insignificante.

Sobre el papel de España como puente hacia los mercados europeos y la verdadera historia del boom, habría que matizar mucho e investigar más. Creo que se ha exagerado demasiado. El boom fue un fenómeno complejo y global en el que no hubo un solo actor sino varios. Y el protagonismo entre distintas plazas (Buenos Aires, México, La Habana, Barcelona, Paris) fue compartido. Hoy la situación también se hace cada vez más compleja y global, pues ya España no tiene el monopolio de la venta de los derechos de traducción de autores latinoamericanos, ni París es ya la única vitrina de la literatura mundial. Tanto el capital simbólico como el capital económico están más dispersos y la producción de valor, a nivel global, se ha fragmentado y atomizado. Es más difícil llegar a consensos críticos. Mira, si no, las interminables y dispares listas con que la prensa internacional nos castiga cada fin de año en París, Barcelona, Buenos Aires, Nueva York, México o Madrid.

Foto de archivo. El escritor durante una reunión de amigos. Horizontal

De izquierda a derecha: Castellet, García Márquez, Barral, Vargas Llosa, Félix de Azúa, Salvador Clotas, Cortázar y García Hortelano.

En el caso del boom, se asume a menudo que el espacio clave es Barcelona, y la agencia de Carmen Balcells en particular, para su internacionalización. Pero parece lógico pensar que sin traducciones podría haber quedado circunscrito al ámbito hispanohablante, y no fue el caso. ¿Qué pesa más en esa internacionalización, el hecho de que autores como Cortázar residan en París o la existencia de una larga tradición de relaciones entre Latinoamérica y Francia, quizá peor conocida? ¿Qué papel atribuyes en ello a Carmen Balcells?

Carmen Balcells transformó la venta de derechos de traducción en un negocio global. Su modelo fue el del marchant d’art que se implicaba en la vida y la obra de los artistas que representaba y los acompañaba en su aventura creativa. En este sentido, era una mujer notabilísima, que respetaba a sus autores, los conocía y conocía la literatura cuyos derechos de traducción negociaba. Ahora bien, sin el contexto internacional que trajo consigo la Revolución Cubana, sin la potencia y la experiencia del polo editorial de Buenos Aires (ahí estaban Sudamericana, Losada y tantas otras casas), sin las traducciones de la colección de Roger Caillois (que circulaban por toda Europa y llegaban a los Estados Unidos), sin Carlos Barral y sus premios, y en fin… sin tantos otros factores, como el genio de Cortázar, García Márquez y Vargas Llosa, sin todo esto no habría habido ningún boom. Así que no exageremos tanto, por mucho que queramos a Carmen y que nos guste Barcelona.

castelletvalverdepetitbarralvseix

De izquierda a derecha: Castellet, José M. Valverde, Joan Petit, Barral y Víctor Seix.

Lo que sí habría que subrayar es que Carmen, como la mayoría de las agentes españolas, era ante todo una gran lectora de sus autores, los conocía y conocía perfectamente sus obras, y cuando hablaba con un editor extranjero, sabía de qué le estaba hablando y sabían también con quién estaba hablando. Por encima de todo, era una mujer que conocía y amaba la literatura que se escribe en español en las dos orillas de la lengua. No siempre es el caso hoy, ya que la venta de derechos está a veces en manos de agentes que no leen el español ni saben nada de sus literaturas ni se interesan de veras en nuestros escritores; o solo saben hablar de su potencial comercial.

Posteriormente, enterrado ya Franco, París volvió a ser un núcleo de difusión importante en relación a la promoción de escritores españoles como Muñoz Molina (n. 1956), Julio Llamazares (n. 1955), Juan José Millás (n. 1952), Javier Marías (n. 1952), Luis Landero (n. 1948), etc., ¿no?

Rafael Conte (1935-2009).

Es cierto. Allá por los ochenta, cuando trabajaba en le Seuil, la promoción de la nueva ola española fue una de nuestras prioridades. Rafael Conte, amigo de la casa, hizo mucho por ellos. También José Miguel Ullán. Recuerdo el lanzamiento de las novelas de Eduardo Mendoza, o de los libros de la cuentista Cristina Fernández Cubas en París. Fue un gran momento de la narrativa española en Francia. Y creo que tuvo repercusiones en toda Europa, ciertamente.

 

En el caso de la literatura catalana, lo habitual es ampliar los lectores mediante la traducción primero al español, pero no fue ese el caso de Joan Sales y su Incerta glòria, cuya primera traducción fue la de Bernard Lesfargues al francés como Gloire incertaine en 1962 (la española, de Carlos Pujol, tuvo que esperar hasta 1969), pero que gracias a que apareció en una editorial como Gallimard luego fue contratada enseguida en otros países. Hay una vocación explícita, parece, de actuar desde Gallimard como puente entre culturas a través de las traducciones, ¿no es así?

Pascale Casanova habla en su libro La République Mondiale des Lettres (1998) del «efecto París», para referirse al impacto simbólico que supone, a un nivel internacional, la traducción al francés de un autor extranjero. No sé si todavía París tiene esa potestad, pero tradicionalmente las traducciones que publica Gallimard sí han tenido ese efecto canónico, un suplemento evaluativo reconocido por premios internacionales como el Nobel. La correspondencia de Caillois con muchos editores extranjeros constituye un registro de este modo de circulación de las traducciones francesas y de la atención que se les prestaba, que aún se les presta, a nivel internacional.

En la misma colección donde Gallimard sitúa, por ejemplo, las obras de Sándor Márai, Pasternak, Faulkner o Kundera, Du Monde Entier, puede encontrarse el Cahier gris de Josep Pla, Frémisante mémoire de Jesús Moncada, La place du Diamant, de Mercè Rodoreda. Y el tándem Ramón Chao-Serge Mestre ha traducido directamente del gallego varias obras de Manuel Rivas en diversas colecciones de Gallimard, que al parecer han sido en general bien acogidas. ¿Estas obras en otras lenguas peninsulares, llegan a Gallimard a través de traducciones previas al español, o hay una mirada puesta en el canon y las novedades de las literaturas gallega y catalana?

salesgallimard1962Sí se les ha dado una atención especial a las lenguas de la Península. Manuel Rivas se traduce en Gallimard directamente del gallego, como Moncada y Pla del catalán. Desde 1996 he tratado de tener siempre en mi equipo lectores de las diversas lenguas peninsulares y también de portugués, por supuesto. Rivas y Pla, entre otros, han sido acogidos con bastante éxito. De hecho, una de las aventuras editoriales más felices de estos últimos años fue la traducción integral del Quadern Gris, que solo se conocía en francés en una versión fragmentaria y muy reducida. Pla faltaba en el catálogo de Gallimard y traerlo fue como cumplir con una deuda pendiente para con un autor tan excepcional y tan francófilo. Sueño con traducir un día sus libros de vagabundeos gastronómicos.

Hay una impresión bastante generalizada de que en Francia hay un mayor reconocimiento hacia la labor del traductor, ¿responde eso a la realidad y, en tal caso, a qué lo atribuyes? Podría sorprender que en las traducciones francesas suele indicarse en los créditos si la traducción es del español de Chile, de Argentina, de Colombia o de México, ¿cómo encaja eso con la pretendida unidad de la lengua española?

Los traductores franceses han sostenido durante muchos años un largo combate para que se reconozcan sus derechos. Hoy se les tiende a considerar cada vez más como re-escritores y por ende como co-creadores de la obra que traducen. De ahí que su nombre aparezca sistemáticamente junto al del autor en las portadillas y los créditos. Me parece más que justo. Necesario.

También era justo y necesario hacerle un lugar a las variaciones del español y a los diversos españoles americanos. Siempre se indica en la portada, cuando se traduce del español, si procede de México, Cuba, Chile, etc. La lingüística reconoce la importancia de estas modalidades más allá o más acá de la unidad de la lengua, que es sobre todo un asunto político, no literario ni editorial ni científico.

josephinefelliermarcellinkristevabartheswahlsarduy

De izquierda a derecha: Josephine Fellier, Julia Kristeva, Roland Barthes, François Wahl y Severo Sarduy en los tiempos de Tel Quel.

En tanto que editor, no estrictamente como lector, ¿qué editor o editores te parece que por su modo de enfocar el trabajo, su talante o su obra te han servido de modelos o has aprendido de ellos?

Son muchos y es difícil no ser desagradecido e injusto. Ya te hablé de Sarduy y de Wahl. A ambos les debo una cierta fidelidad a las estéticas y al pensamiento de vanguardia. También los Gallimard han sido un modelo por la manera como reparten el peso entre el valor literario y las expectativas económicas: «encuentre usted buenos libros y el servicio comercial encontrará la forma de venderlos», me dijo Antoine Gallimard en nuestra primera entrevista.

Tendría que citar asimismo a Jorge Herralde por razones semejantes: en medio del huracán neoliberal, entre los noventa y dos mil, la literatura siguió siendo un valor en el catálogo de Anagrama y hoy se puede leer en él una propuesta de escritura/lectura arriesgada, influyente y sólida. No debería olvidar tampoco a los dos Manolos de Pre-Textos, Borrás y Ramírez, que desde Valencia nos siguen dando lo mejor de la poesía y el pensamiento contemporáneo contra viento y marea. Se me ocurren tantos otros nombres de colegas y amigos tan notables y tan diferentes, como Pilar Reyes y Jaume Vallcorba, como Joan Tarrida y Juan Casamayor; de todos ellos he aprendido algo en distintos momentos de estos años.

canagrama

De izquierda a derecha: Gustavo Guerrero, Lali Gubern y Jorge Herralde en la Feria de Frankfurt 2012.

Entre las generaciones más recientes, habría que citar a editores latinoamericanos como Leonora Djament de Eterna Cadencia, Eduardo Rabasa de Sexto Piso o Matías Rivas de la Diego Portales, que asocian la publicación de ensayos de humanidades, teoría y ciencias sociales, con literatura de la más alta exigencia. De hecho, algunas de las voces claves entre las nuevas generaciones de narradores y ensayistas han salido de esos catálogos. Acaso el factor común que los une es una apuesta por la innovación en pos de otro equilibrio entre las dos caras del oficio editorial – la comercial y la intelectual – después de unos años en que parecía que el afán de rentabilidad y los grandes conglomerados lo iban a devorar todo.

Algunos críticos literarios y profesores muy vinculados al sector editorial evitan ejercer la crítica literaria cuando esta puede entrar en conflicto con autores representados, editados o incluso con amigos, y de ahí que sólo reseñen obras de autores que, en ese plano y también en el académico, les quedan lejos. Tú, en cambio, tanto en la Nouvelle Revue Française como en Cuadernos Hispanoamericanos o Letras Libres siempre te has ocupado de las novedades de la literatura hispanoamericana, que ha sido también tu campo preferente tanto en la universidad como en el sector editorial. ¿Cómo se lleva esa cuádruple vertiente de escritor, editor, profesor y crítico literario? ¿No se producen ciertas tensiones en el momento de enjuiciar la obra de autores próximos en alguno de esos sentidos?

Tienes toda la razón. Claro que se produce una cierta tensión cuando se ocupan tantos lugares a la vez en el campo literario y hasta puede haber cierto conflicto de intereses. Esto me ha llevado a reducir drásticamente la publicación de reseñas y artículos de crítica en los últimos años, muy a mi pesar porque llegué a la edición a través de la crítica literaria y porque esa vocación primera sigue siendo con la que más me identifico y la que me ha dado más satisfacciones.

Además, el tener que leer continuamente todo lo que se está publicando dentro de área hispánica suele darte una visión bastante privilegiada de lo que se está escribiendo en un momento dado. Si no he descartado del todo seguir haciendo crítica, es porque, como te decía, veo al acto de editar como una continuación o prolongación del gesto crítico por otras vías: es una propuesta de escritura/lectura que, como la de una reseña o un artículo, puede ser más o menos acertada y recibir una acogida favorable o desfavorable. Por eso a veces me permito escribir sobre los autores que edito, en revistas españolas o latinoamericanas y aun ocurre que los incluya en algún curso o seminario universitario. Es otra manera de publicar y de compartir una propuesta de escritura/lectura. También me permito escribir sobre autores a los que no edito por una razón u otra, pero cuyas obras me interesan o entusiasman.

grupoeds

De izquierda a derecha: Elizardo Martinez (Ediciones El Callejón), Gustavo Guerrero, Leonora Djament (Eterna Cadencia), Juan Casamayor (Paginas de Espuma), Antonio José Ponte (El Diario de Cuba) y Eduardo Rabasa (Sexto Piso), en marzo de 2016

Fuentes adicionales:

Catherine Fel, «Entretien avec Gustavo Guerrero, responsable du domain hispanophone chez Gallimard», Bureau International de L´Édition Française, marzo de 2009.

Gustavo Guerrero «Vivimos una tendencia a la novelización», entrevista en vídeo en Casa América, 7 de octubre de 2011.

guerreroanagrama

Libro con el que Gustavo Guerrero obtuvo el Premio Anagrama de Ensayo 2008.

Gustavo Guerrero, «La mediación editorial, la traducción y la difusión de las literaturas latinoamericanas en Francia: el proyecto Medet-Lat France. 1950-2000», conferencia en el Seminario Internacional Redes públicas, relaciones editoriales. Hacia una historia cultural de la edición iberoamericana, 22 de noviembre de 2016.

María Pizarro Prada, «4 preguntas a Gustavo Guerrero», en el blog de Iberoamericana/Vervuert, 5 de noviembre de 2012.

Susana Reinoso, «Gallimard y los lectores», publicado en Ñ, y en Función Lenguaje (sin indicación de fecha).

Web sobre la historia de Gallimard, de la colección Du Monde Entier y web de Éditions du Seuil.